Відкрити головне меню

HTR2A (англ. 5-hydroxytryptamine receptor 2A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 13-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 471 амінокислот, а молекулярна маса — 52 603[5].

HTR2A
5ht2a.jpg
Ідентифікатори
Символи HTR2A, 5-HT2A, HTR2, 5-hydroxytryptamine receptor 2A
Зовнішні ІД OMIM: 182135 MGI: 109521 HomoloGene: 68073 GeneCards: HTR2A
Реагує на сполуку
LP-12, LP-44, 5-carboxamidotryptamine, Серотонін, 5-methoxytryptamine, (+/-)-8-hydroxy-2-(di-N-propylamino)tetralin, AL-37350A, α-methyl-5-HT, aripiprazole, brl-15572, (RS)-brolamfetamine, BW723C86, Каберголін, cgs 12066b-parent, 4-iodo-2,5-dimethoxyphenylisopropylamine, donitriptan, gr-127935, lorcaserin, ЛСД, methylergonovine, MK-212, Org 12962, ORG-37684, pergolide, Піндолол, Кветіапін, quinpirole, quipazine, ru-24969, sb-216641, 1-(3-trifluoromethylphenyl)piperazine, триптамін, VER-3323, Бромокриптин, ergotamine, m-chlorophenylpiperazine, lisuride, terguride, Агомелатин, Апоморфін, blonanserin, bufotenine, (+)-butaclamol, cyamemazine, Дулоксетин, Флібансерин, Флуфеназин, fluspirilene, glemanserin, Галоперидол, ketanserin, L-741,626, LY215840, mesoridazine, mesulergine, metergoline, metitepine, methysergide, Міансерин, Міртазапін, molindone, nefazodone, olanzapine, perphenazine, Пімозид, pipamperone, ritanserin, roxindole, RS-102221, RS-127445, sarpogrelate, sb-206553, SB 242084, SB 243213, SDZ SER-082, Сертиндол, spiperone, spiramide, Тіоридазин, (Z)-thiothixene, Тразодон, Трифлуоперазин, volinanserin, Вортіоксетин, xanomeline, ziprasidone, zotepine, Хлорпромазин, clozapine, loxapine, pimavanserin, risperidone[1]
Шаблон експресії
PBB GE HTR2A 211616 s at fs.png

PBB GE HTR2A 207135 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001165947
NM_000621
NM_172812
RefSeq (білок)
NP_000612
NP_001159419
NP_766400
Локус (UCSC) Хр. 13: 46.83 – 46.9 Mb Хр. 14: 74.64 – 74.71 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSE
NRTNLSCEGCLSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVS
LEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWPLPSKLCAV
WIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVW
TISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSFFIPLTIM
VITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICK
ESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYK
ENKKPLQLILVNTIPALAYKSSQLQMGQKKNSKQDAKTTDNDCSMVALGK
QHSEEASKDNSDGVNEKVSCV

Кодований геном білок за функціями належить до рецепторів клітини-хазяїна для входу віруса, рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних відростках, цитоплазматичних везикулах.

ЛітератураРедагувати

  • Chen K., Yang W., Grimsby J., Shih J.C. (1992). The human 5-HT2 receptor is encoded by a multiple intron-exon gene.. Brain Res. Mol. Brain Res. 14: 20 — 26.  PubMed DOI:10.1016/0169-328X(92)90005-V
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nichols D.E., Nichols C.D. (2008). Serotonin receptors.. Chem. Rev. 108: 1614 — 1641.  PubMed DOI:10.1021/cr078224o
  • Knauer C.S., Campbell J.E., Chio C.L., Fitzgerald L.W. (2009). Pharmacological characterization of mitogen-activated protein kinase activation by recombinant human 5-HT2C, 5-HT2A, and 5-HT2B receptors.. Naunyn Schmiedebergs Arch. Pharmacol. 379: 461 — 471.  PubMed DOI:10.1007/s00210-008-0378-4
  • Albizu L., Holloway T., Gonzalez-Maeso J., Sealfon S.C. (2011). Functional crosstalk and heteromerization of serotonin 5-HT2A and dopamine D2 receptors.. Neuropharmacology 61: 770 — 777.  PubMed DOI:10.1016/j.neuropharm.2011.05.023
  • Marshall S.E., Bird T.G., Hart K., Welsh K.I. (1999). Unified approach to the analysis of genetic variation in serotonergic pathways.. Am. J. Med. Genet. 88: 621 — 627.  PubMed DOI:10.1002/(SICI)1096-8628(19991215)88:6<621::AID-AJMG9>3.0.CO;2-H

ПриміткиРедагувати

Див. такожРедагувати