Відкрити головне меню

HTR1A (англ. 5-hydroxytryptamine receptor 1A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 422 амінокислот, а молекулярна маса — 46 107[5].

HTR1A
Ідентифікатори
Символи HTR1A, 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled, 5-HT-1A, 5-HT1A, 5HT1a, ADRB2RL1, ADRBRL1, G-21, PFMCD, 5-hydroxytryptamine receptor 1A
Зовнішні ІД OMIM: 109760 MGI: 96273 HomoloGene: 20148 GeneCards: HTR1A
Реагує на сполуку
Флібансерин, frovatriptan, LP-12, LP-211, LP-44, 1-naphthylpiperazine, 5-carboxamidotryptamine, Серотонін, (+/-)-8-hydroxy-2-(di-N-propylamino)tetralin, aripiprazole, bmy-14802, Каберголін, clozapine, CP 93129, donitriptan, eletriptan, EMDT, flesinoxan, lisuride, ЛСД, LY293284, LY334370, nafadotride, naratriptan, f-15599, ocaperidone, olanzapine, Кветіапін, quinpirole, rizatriptan, ru-24969, S-14506, S-14671, spiroxatrine, sumatriptan, tandospirone, U92016A, xanomeline, zalospirone, zolmitriptan, Апоморфін, bmy-7378 free base, brl-15572, Бромокриптин, Буспірон, fluparoxan, gr-127935, ipsapirone, pergolide, Пірибедил, roxindole, S-15535, sb-216641, terguride, vilazodone, Вортіоксетин, ziprasidone, (+)-butaclamol, Хлорпромазин, cyamemazine, fluspirilene, Галоперидол, iloperidone, DL-Apiose, ketanserin, mesoridazine, metitepine, NAN 190, Пімозид, Піндолол, pipamperone, pizotyline, raclopride, repinotan, risperidone, ritanserin, robalzotan, sertindole, spiperone, Тіоридазин, tiospirone, WAY-100135, WAY-100635, yohimbine, zotepine[1]
Шаблон експресії
PBB GE HTR1A 221351 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000524
NM_008308
RefSeq (білок)
NP_000515
NP_032334
Локус (UCSC) Хр. 5: 63.96 – 63.96 Mb Хр. 13: 105.44 – 105.45 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCA
VLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN
KWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTP
RRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYST
FGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQP
KKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGII
MGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIY
AYFNKDFQNAFKKIIKCKFCRQ

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • Kitano T., Liu Y.-H., Ueda S., Saitou N. (2004). Human-specific amino acid changes found in 103 protein-coding genes.. Mol. Biol. Evol. 21: 936 — 944.  PubMed DOI:10.1093/molbev/msh100
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Parks C.L., Chang L.S., Shenk T. (1991). A polymerase chain reaction mediated by a single primer: cloning of genomic sequences adjacent to a serotonin receptor protein coding region.. Nucleic Acids Res. 19: 7155 — 7160.  PubMed DOI:10.1093/nar/19.25.7155
  • Nichols D.E., Nichols C.D. (2008). Serotonin receptors.. Chem. Rev. 108: 1614 — 1641.  PubMed DOI:10.1021/cr078224o
  • Polter A.M., Li X. (2010). 5-HT1A receptor-regulated signal transduction pathways in brain.. Cell. Signal. 22: 1406 — 1412.  PubMed DOI:10.1016/j.cellsig.2010.03.019
  • Jiang Y.C., Wu H.M., Cheng K.H., Sunny Sun H. (2012). Menstrual cycle-dependent febrile episode mediated by sequence-specific repression of poly(ADP-ribose) polymerase-1 on the transcription of the human serotonin receptor 1A gene.. Hum. Mutat. 33: 209 — 217.  PubMed DOI:10.1002/humu.21622

ПриміткиРедагувати

Див. такожРедагувати