Відкрити головне меню

HRH1 (англ. Histamine receptor H1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 487 амінокислот, а молекулярна маса — 55 784[5].

HRH1
H1 Receptor with Doxepin.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HRH1, H1-R, H1R, HH1R, hisH1, histamine receptor H1
Зовнішні ІД OMIM: 600167 MGI: 107619 HomoloGene: 668 GeneCards: HRH1
Реагує на сполуку
vilazodone, 2-pyridineethanamine, Гістамін, Амітриптилін, aripiprazole, Астемізол, Азеластин, Хлорфенамін, Хлорпромазин, ciproxifan, Клемастин, clobenpropit, clozapine, conessine, cyclizine, Ципрогептадин, Дезлоратадин, Димедрол, epinastine, Фексофенадин, fluphenazine, fluspirilene, Галоперидол, Гідроксизин, impromidine, Кетотифен, Лоратадин, loxapine, MK-0249, molindone, olanzapine, perphenazine, Пімозид, pipamperone, pitolisant, Прометазин, Кветіапін, risperidone, sertindole, Терфенадин, Тіоридазин, (Z)-thiothixene, trifluoperazine, tripelennamine, triprolidine, ziprasidone, zotepine, abt-239, Цетиризин, Левоцетиризин, pyrilamine[1]
Шаблон експресії
PBB GE HRH1 205579 at fs.png

PBB GE HRH1 205580 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000861
NM_001098211
NM_001098212
NM_001098213
RefSeq (білок)
NP_000852
NP_001091681
NP_001091682
NP_001091683
Локус (UCSC) Хр. 3: 11.14 – 11.26 Mb Хр. 6: 114.4 – 114.48 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLY
AVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLC
LFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRTKTRASATILG
AWFLSFLWVIPILGWNHFMQQTSVRREDKCETDFYDVTWFKVMTAIINFY
LPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKK
PGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQ
MLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQ
YVSGLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCKNCCNEHLH
MFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRS

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • Kitano T., Liu Y.-H., Ueda S., Saitou N. (2004). Human-specific amino acid changes found in 103 protein-coding genes.. Mol. Biol. Evol. 21: 936 — 944.  PubMed DOI:10.1093/molbev/msh100
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Horio S., Kato T., Ogawa M., Fujimoto K., Fukui H. (2004). Two threonine residues and two serine residues in the second and third intracellular loops are both involved in histamine H1 receptor downregulation.. FEBS Lett. 573: 226 — 230.  PubMed DOI:10.1016/j.febslet.2004.07.072

ПриміткиРедагувати

Див. такожРедагувати