Відкрити головне меню

HTR2C (англ. 5-hydroxytryptamine receptor 2C) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[4] Довжина поліпептидного ланцюга білка становить 458 амінокислот, а молекулярна маса — 51 821[5].

HTR2C
Ідентифікатори
Символи HTR2C, 5-HT2C, 5-5HTR1C, 5-HT1C, 5-HT2C receptor, 5-hydroxytryptamine receptor 2C
Зовнішні ІД OMIM: 312861 MGI: 96281 HomoloGene: 20242 GeneCards: HTR2C
Реагує на сполуку
lorcaserin, 5-carboxamidotryptamine, Серотонін, 5-MeO-DMT, 5-methoxytryptamine, (+/-)-8-hydroxy-2-(di-N-propylamino)tetralin, AL-37350A, α-methyl-5-HT, aripiprazole, (RS)-brolamfetamine, BW723C86, Каберголін, cgs 12066b-parent, 4-iodo-2,5-dimethoxyphenylisopropylamine, ЛСД, methylergonovine, MK-212, Org 12962, ORG-37684, oxymetazoline, quinpirole, quipazine, ru-24969, 1-(3-trifluoromethylphenyl)piperazine, триптамін, VER-3323, YM348, brl-15572, Бромокриптин, ergotamine, gr-127935, m-chlorophenylpiperazine, lisuride, pergolide, sb-216641, Агомелатин, Апоморфін, Хлорпромазин, cyamemazine, Дулоксетин, glemanserin, ketanserin, mesoridazine, methysergide, Міртазапін, perphenazine, ritanserin, roxindole, RS-102221, RS-127445, sarpogrelate, SB 204741, sb-206553, SB 242084, SB 243213, SDZ SER-082, spiperone, spiramide, terguride, Тіоридазин, Тразодон, Трифлуоперазин, volinanserin, Вортіоксетин, xanomeline, clozapine, loxapine, mesulergine, metergoline, metitepine, Міансерин, olanzapine, risperidone, sertindole, tiospirone, ziprasidone, zotepine, idalopirdine[1]
Шаблон експресії
PBB GE HTR2C 211479 s at fs.png

PBB GE HTR2C 207307 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001256761
NM_000868
NM_001256760
NM_008312
RefSeq (білок)
NP_000859
NP_001243689
NP_001243690
NP_032338
Локус (UCSC) Хр. X: 114.58 – 114.91 Mb Хр. X: 146.96 – 147.2 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPD
GVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADM
LVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISL
DRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKV
FVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLH
GHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLL
NVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPR
VAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSV
VSERISSV

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • Xie E., Zhao L., Levine A.J., Shenk T., Chang L.-S. (1996). The human serotonin 5-HT2C receptor: complete cDNA, genomic structure, and alternatively spliced variant.. Genomics 35: 551 — 561.  PubMed DOI:10.1006/geno.1996.0397
  • Niswender C.M., Sanders-Bush E., Emeson R.B. (1998). Identification and characterization of RNA editing events within the 5-HT2C receptor.. Ann. N. Y. Acad. Sci. 861: 38 — 48.  PubMed DOI:10.1111/j.1749-6632.1998.tb10171.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Schaerlinger B., Hickel P., Etienne N., Guesnier L., Maroteaux L. (2003). Agonist actions of dihydroergotamine at 5-HT2B and 5-HT2C receptors and their possible relevance to antimigraine efficacy.. Br. J. Pharmacol. 140: 277 — 284.  PubMed DOI:10.1038/sj.bjp.0705437
  • Marion S., Oakley R.H., Kim K.-M., Caron M.G., Barak L.S. (2006). A beta-arrestin binding determinant common to the second intracellular loops of rhodopsin family G protein-coupled receptors.. J. Biol. Chem. 281: 2932 — 2938.  PubMed DOI:10.1074/jbc.M508074200
  • Nichols D.E., Nichols C.D. (2008). Serotonin receptors.. Chem. Rev. 108: 1614 — 1641.  PubMed DOI:10.1021/cr078224o

ПриміткиРедагувати

Див. такожРедагувати