FGF16

білок-кодуючий ген Homo Sapiens

FGF16 (англ. Fibroblast growth factor 16) – білок, який кодується однойменним геном, розташованим у людей на довгому плечі X-хромосоми.[4][5][6] Довжина поліпептидного ланцюга білка становить 207 амінокислот, а молекулярна маса — 23 759[7].

FGF16
Ідентифікатори
Символи FGF16, FGF-16, MF4, fibroblast growth factor 16
Зовнішні ІД OMIM: 300827 MGI: 1931627 HomoloGene: 11057 GeneCards: FGF16
Пов'язані генетичні захворювання
syndactyly type 8[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003868
NM_030614
RefSeq (білок)
NP_003859
NP_085117
Локус (UCSC) Хр. X: 77.45 – 77.46 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSP
TDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLA
VGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYAST
LYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMS
RDLFHYR

Кодований геном білок за функціями належить до факторів росту, фосфопротеїнів.

Секретований назовні.

СтруктураРедагувати

ГенРедагувати

Ген FGF16 у ссавців містить 2 екзони та охоплює 2,37 кб геномної ДНК. Він розташований на Х-хромосомі на положенні Xq21.

Експресується в клітинах серця кардіоміоцитах[8], клітинах яєчника[9] та клітинах коричневої жирової тканини[10] людини.

БілокРедагувати

Білок FGF16 класифікується як гепарин-зв'язаний фактор росту, належить до підгрупи факторів росту фібробластів FGF9. Незважаючи на те, що FGF16 також FGF, він працює протилежно таким білкам, як FGF2, що також належать до FGF.

Гомологічно є ортологом мишачого FGF16 (подібність на 98,6%) та щурячого FGF16 (подібність на 99,5%).[5]

Секретований назовні.

ФункціїРедагувати

Білок, який кодується цим геном, є членом сімейства фактора росту фібробластів (FGF). Члени сімейства FGF володіють широкою мітогенною та клітиною виживаючою діяльністю і беруть участь у різних біологічних процесах, включаючи ембріональний розвиток, ріст клітин, морфогенез, відновлення тканин, ріст пухлини та інвазія. Гомолог щурів переважно експресується в ембріональній коричневій жировій тканині і має значну мітогенну активність, що говорить про роль у проліферації ембріональної коричневої жирової тканини.[10]

Відіграє важливу роль в регуляції ембріонального розвитку, проліферації клітин і диференціації клітин, і необхідий для нормальної проліферації кардіоміоцитів і розвитку серця. Необхідний для розвитку ембріонального серця в середині гестації через його позитивний вплив на ріст міокарда.[11] Є мішенню для активації NF-κB[en] в постнатальному серці.[8]

Виявлено мутації в цьому гені, пов'язані з випадками X-зв'язаного рецесивного метакарпального 4/5 злиття.[12]

Взаємодії та клінічне значенняРедагувати

FGF16 взаємодіє з FGF2, виступаючи його антагоністом, і таким чином запобігає потенційно індуковану ангіотензином II гіпертрофію і фіброз серця. [13] FGF16 переважно експресується в серці. Індукована ангіотензином II гіпертрофія серця і фіброз значною мірою сприяє посиленню експресії TGF-Β1. У кардіоміоцитах експресії FGF16 сприяла наявність FGF2. Крім того, FGF16 антагонізує FGF2-індуковану експресію TGF-B1 у культивованих кардіоміоцитах.

Регуляція FGF16 відбувається за участі PITX2 гомодоменного фактору транскрипції. PITX2 взаємодіє з FGF16 та регулює його експресію. [9] FGF16 експресується в яєчнику людини, і його експресія помітно збільшується в пухлинах яєчників. FGF16 стимулює проліферацію клітин аденокарциноми яєчників людини,SKOV-3[en]. Крім того, завдяки активації внутрішньоклітинного шляху МАРК, опосередкованого FGF-рецептором, FGF16 регулює експресію MMP2, MMP9, SNAI1 і CDH1 і, таким чином, полегшує клітинну інвазію. Інгібування FGF16, і загалом рецепторів фактора росту фібробластів, а також шляху MAPK знижує проліферативну і інвазивну поведінку ракових клітин яєчників.

ЛітератураРедагувати

  • Turner N., Grose R. (2010). Fibroblast growth factor signalling: from development to cancer.. Nat. Rev. Cancer 10: 116 — 129.  PubMed DOI:10.1038/nrc2780

ПриміткиРедагувати

  1. Захворювання, генетично пов'язані з FGF16 переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:3672 (англ.). Процитовано 22 вересня 2017. 
  5. а б Miyake, A.; Konishi, M.; Martin, F. H.; Hernday, N. A.; Ozaki, K.; Yamamoto, S.; Mikami, T.; Arakawa, T. та ін. (1998-02-04). Structure and expression of a novel member, FGF-16, on the fibroblast growth factor family. Biochemical and Biophysical Research Communications 243 (1). с. 148–152. ISSN 0006-291X. PMID 9473496. Процитовано 2019-01-16. 
  6. Kim, H.-S. (2001). The human FGF gene family: chromosome location and phylogenetic analysis. Cytogenetic and Genome Research (english) 93 (1-2). с. 131–132. ISSN 1424-8581. PMID 11474196. doi:10.1159/000056965. Процитовано 2019-01-16. 
  7. UniProt, O43320 (англ.). Процитовано 22 вересня 2017. 
  8. а б Sofronescu, Alina G.; Jin, Yan; Cattini, Peter A. (2008-4). A myocyte enhancer factor 2 (MEF2) site located in a hypersensitive region of the FGF16 gene locus is required for preferential promoter activity in neonatal cardiac myocytes. DNA and cell biology 27 (4). с. 173–182. ISSN 1557-7430. PMID 18260768. doi:10.1089/dna.2007.0689. Процитовано 2019-01-16. 
  9. а б Basu, Moitri; Mukhopadhyay, Satinath; Chatterjee, Uttara; Roy, Sib Sankar (2014-01-17). FGF16 promotes invasive behavior of SKOV-3 ovarian cancer cells through activation of mitogen-activated protein kinase (MAPK) signaling pathway. The Journal of Biological Chemistry 289 (3). с. 1415–1428. ISSN 1083-351X. PMC PMC3894325. PMID 24253043. doi:10.1074/jbc.M113.535427. Процитовано 2019-01-16. 
  10. а б FGF16 fibroblast growth factor 16 [Homo sapiens (human)] - Gene - NCBI. www.ncbi.nlm.nih.gov. Процитовано 2019-01-16. 
  11. Lu, Shun Yan; Sheikh, Farah; Sheppard, Patricia C.; Fresnoza, Agnes; Duckworth, Mary Lynn; Detillieux, Karen A.; Cattini, Peter A. (2008-08-22). FGF-16 is required for embryonic heart development. Biochemical and Biophysical Research Communications 373 (2). с. 270–274. ISSN 1090-2104. PMC PMC5233434. PMID 18565327. doi:10.1016/j.bbrc.2008.06.029. Процитовано 2019-01-16. 
  12. Mundlos, Stefan; Socha, Magdalena; Glazar, Renata; Doelken, Sandra C.; Krawitz, Peter; Hecht, Jochen; Stricker, Sigmar; Kolanczyk, Mateusz та ін. (2013-09-01). Whole exome sequencing identifies FGF16 nonsense mutations as the cause of X-linked recessive metacarpal 4/5 fusion. Journal of Medical Genetics (en) 50 (9). с. 579–584. ISSN 0022-2593. PMID 23709756. doi:10.1136/jmedgenet-2013-101659. Процитовано 2019-01-16. 
  13. Matsumoto, Emi; Sasaki, Sayaka; Kinoshita, Hideyuki; Kito, Takuya; Ohta, Hiroya; Konishi, Morichika; Kuwahara, Koichiro; Nakao, Kazuwa та ін. (2013-7). Angiotensin II-induced cardiac hypertrophy and fibrosis are promoted in mice lacking Fgf16. Genes to Cells: Devoted to Molecular & Cellular Mechanisms 18 (7). с. 544–553. ISSN 1365-2443. PMC PMC3738920. PMID 23600527. doi:10.1111/gtc.12055. Процитовано 2019-01-16. 

Див. такожРедагувати