Відкрити головне меню

MMP9

білок-кодуючий ген Homo Sapiens

MMP9 (англ. Matrix metallopeptidase 9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 707 амінокислот, а молекулярна маса — 78 458[4].

MMP9
Protein MMP9 PDB 1itv.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MMP9, CLG4B, GELB, MANDP2, MMP-9, 92 kDa type IV collagenase, 92 kDa gelatinase, gelatinase B, matrix metallopeptidase 9
Зовнішні ІД OMIM: 120361 MGI: 97011 HomoloGene: 3659 GeneCards: MMP9
Шаблон експресії
PBB GE MMP9 203936 s at.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004994
NM_013599
RefSeq (білок)
NP_004985
NP_038627
Локус (UCSC) Хр. 20: 46.01 – 46.02 Mb Хр. 2: 164.94 – 164.96 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLY
RYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCG
VPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSA
VTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQG
DAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRS
DGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFP
FTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAA
HEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPE
PRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAG
PSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRP
QGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEV
DRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYD
ILQCPED

Кодований геном білок за функціями належить до гідролаз, протеаз, металопротеаз. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном кальцію. Локалізований у позаклітинному матриксі. Також секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Sang Q.X., Birkedal-Hansen H., Van Wart H.E. (1995). Proteolytic and non-proteolytic activation of human neutrophil progelatinase B.. Biochim. Biophys. Acta 1251: 99 — 108.  PubMed DOI:10.1016/0167-4838(95)00086-A
  • Masure S., Proost P., van Damme J., Opdenakker G. (1991). Purification and identification of 91-kDa neutrophil gelatinase. Release by the activating peptide interleukin-8.. Eur. J. Biochem. 198: 391 — 398.  PubMed DOI:10.1111/j.1432-1033.1991.tb16027.x
  • Cha H., Kopetzki E., Huber R., Lanzendoerfer M., Brandstetter H. (2002). Structural basis of the adaptive molecular recognition by MMP9.. J. Mol. Biol. 320: 1065 — 1079.  PubMed DOI:10.1016/S0022-2836(02)00558-2
  • Sato H., Seiki M. (1993). Regulatory mechanism of 92 kDa type IV collagenase gene expression which is associated with invasiveness of tumor cells.. Oncogene 8: 395 — 405.  PubMed
  • Ogata Y., Enghild J.J., Nagase H. (1992). Matrix metalloproteinase 3 (stromelysin) activates the precursor for the human matrix metalloproteinase 9.. J. Biol. Chem. 267: 3581 — 3584.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7176 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P14780 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати