Відкрити головне меню

DRD3

білок-кодуючий ген Homo Sapiens

DRD3 (англ. Dopamine receptor D3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 400 амінокислот, а молекулярна маса — 44 225[5].

DRD3
3PBL (D3).png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DRD3, D3DR, ETM1, FET1, dopamine receptor D3
Зовнішні ІД OMIM: 126451 MGI: 94925 HomoloGene: 623 GeneCards: DRD3
Реагує на сполуку
PF-592379, Ропінірол, Ротиготин, vilazodone, 7-hydroxy-2-(di-N-propylamino)tetralin, Дофамін, Праміпексол, quinelorane, quinpirole, Апоморфін, do-687, Бромокриптин, Каберголін, lisuride, pergolide, Пірибедил, roxindole, terguride, (+)-butaclamol, Хлорпромазин, Клозапін, Домперидон, eticlopride, (Z)-flupentixol, Галоперидол, Локсапін, mesoridazine, nafadotride, nemonapride, perospirone, Пімозид, Прохлорперазин, promazine, raclopride, Рисперидон, SB-277,011-A, Сертиндол, spiperone, Сульпірид, levosulpiride, zotepine[1]
Шаблон експресії
PBB GE DRD3 214559 at fs.png

PBB GE DRD3 211625 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_007877
RefSeq (білок)
NP_000787
NP_001269492
NP_001277738
NP_387512
NP_031903
Локус (UCSC) Хр. 3: 114.13 – 114.2 Mb Хр. 16: 43.75 – 43.82 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLV
CMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSR
ICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRV
ALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLP
FGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHL
ELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHV
LNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • Schmauss C., Haroutunian V., Davis K.L., Davidson M. (1993). Selective loss of dopamine D3-type receptor mRNA expression in parietal and motor cortices of patients with chronic schizophrenia.. Proc. Natl. Acad. Sci. U.S.A. 90: 8942 — 8946.  PubMed DOI:10.1073/pnas.90.19.8942
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lucotte G., Lagarde J.-P., Funalot B., Sokoloff P. (2006). Linkage with the Ser9Gly DRD3 polymorphism in essential tremor families.. Clin. Genet. 69: 437 — 440.  PubMed DOI:10.1111/j.1399-0004.2006.00600.x
  • Giros B., Martres M.-P., Sokoloff P., Schwartz J.-C. (1990). Gene cloning of human dopaminergic D3 receptor and identification of its chromosome.. C. R. Acad. Sci. III, Sci. Vie 311: 501 — 508.  PubMed
  • Liu K., Bergson C., Levenson R., Schmauss C. (1994). On the origin of mRNA encoding the truncated dopamine D3-type receptor D3nf and detection of D3nf-like immunoreactivity in human brain.. J. Biol. Chem. 269: 29220 — 29226.  PubMed

ПриміткиРедагувати

Див. такожРедагувати