Відкрити головне меню

DRD1

білок-кодуючий ген Homo Sapiens

DRD1 (англ. Dopamine receptor D1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 446 амінокислот, а молекулярна маса — 49 293[5].

DRD1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DRD1, dopamine receptor D1, DADR, DRD1A
Зовнішні ІД OMIM: 126449 MGI: 99578 HomoloGene: 30992 GeneCards: DRD1
Реагує на сполуку
a-68930, Апоморфін, Каберголін, Дофамін, fenoldopam, pergolide, Ротиготин, Серотонін, Бромокриптин, lisuride, SKF-38393, (+)-butaclamol, Хлорпромазин, Клозапін, ecopipam, (Z)-flupentixol, Флуфеназин, Галоперидол, ketanserin, mesoridazine, Прохлорперазин, SCH-23390, spiperone, Тіоридазин[1]
Шаблон експресії
PBB GE DRD1 214652 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000794
NM_001291801
NM_010076
RefSeq (білок)
NP_000785
NP_001278730
NP_034206
Локус (UCSC) Хр. 5: 175.44 – 175.44 Mb Хр. 13: 54.05 – 54.06 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIR
FRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWV
AFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTL
SVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSV
ISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKNCQTTTGNGKP
VECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRL
CPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSED
LKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані, мембрані, ендоплазматичному ретикулумі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Jin H., Xie Z., George S.R., O'Dowd B.F. (1999). Palmitoylation occurs at cysteine 347 and cysteine 351 of the dopamine D(1) receptor.. Eur. J. Pharmacol. 386: 305 — 312.  PubMed DOI:10.1016/S0014-2999(99)00727-X

ПриміткиРедагувати

Див. такожРедагувати