CHRM1

білок-кодуючий ген Homo Sapiens

CHRM1 (англ. Cholinergic receptor muscarinic 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 460 амінокислот, а молекулярна маса — 51 421[5].

CHRM1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CHRM1, HM1, M1, M1R, cholinergic receptor muscarinic 1
Зовнішні ІД OMIM: 118510 MGI: 88396 HomoloGene: 20189 GeneCards: CHRM1
Реагує на сполуку
Ацетилхолін, arecoline, bethanechol, milameline, Пілокарпін, sabcomeline, xanomeline, Бруцин, vinburnine, vincamine, Клозапін, norclozapine, staurosporine, aclidinium, AFDX384, Амітриптилін, Біпериден, darifenacin, dicyclomine, glycopyrrolate, himbacine, methoctramine free base, Оксибутинін, Пірензепін, propantheline, Хінукліділ-3-бензилат, Толтеродин, Тригексифенідил, umeclidinium, oxotremorine[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000738
NM_001112697
NM_007698
RefSeq (білок)
NP_000729
NP_001106167
NP_031724
Локус (UCSC) Хр. 11: 62.91 – 62.92 Mb Хр. 19: 8.66 – 8.68 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISF
KVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDL
WLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAW
LVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLP
VTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEG
SPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLA
KRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLW
ELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPG
SVHRTPSRQC

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних контактах, синапсах.

ЛітератураРедагувати

  • Allard W.J., Sigal I.S., Dixon R.A.F. (1987). Sequence of the gene encoding the human M1 muscarinic acetylcholine receptor.. Nucleic Acids Res. 15: 10604 — 10604.  PubMed DOI:10.1093/nar/15.24.10604
  • Chapman C.G., Browne M.J. (1990). Isolation of the human ml (Hml) muscarinic acetylcholine receptor gene by PCR amplification.. Nucleic Acids Res. 18: 2191 — 2191.  PubMed DOI:10.1093/nar/18.8.2191
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Simonin F., Karcher P., Boeuf J.J.-M., Matifas A., Kieffer B.L. (2004). Identification of a novel family of G protein-coupled receptor associated sorting proteins.. J. Neurochem. 89: 766 — 775.  PubMed DOI:10.1111/j.1471-4159.2004.02411.x

ПриміткиРедагувати

Див. такожРедагувати