Відкрити головне меню

Аполіпоротеїн B (англ. Apolipoprotein B) – білок, який кодується геном APOB, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 4 563 амінокислот, а молекулярна маса — 515 605[5].

Аполіпопротеїн B
Ідентифікатори
Символи APOB, FLDB, LDLCQ4, apoB-100, apoB-48, apolipoprotein B, FCHL2
Зовнішні ІД OMIM: 107730 MGI: 88052 HomoloGene: 328 GeneCards: APOB
Пов'язані генетичні захворювання
disease of metabolism, серцево-судинні захворювання, lipid metabolism disorder, familial hypobetalipoproteinemia 1[1]
Шаблон експресії
PBB GE APOB 205108 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000384
NM_009693
RefSeq (білок)
NP_000375
NP_033823
Локус (UCSC) Хр. 2: 21 – 21.04 Mb Хр. 12: 7.98 – 8.02 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLR
KYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLK
EVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEP
TYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVA
TEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLD
AKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFG
EGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNK
LVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKR
VHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVN
NYHKTNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTME
QLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLD
DASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANI
LNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDP
ASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPT
LEALFGKQGFFPDSVNKALYWVNGQVPDGVSKVLVDHFGYTKDDKHEQDM
VNGIMLSVEKLIKDLKSKEVPEARAYLRILGEELGFASLHDLQLLGKLLL
MGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQISS
SGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQ
MNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKT
EVIPPLIENRQSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTR
LELELRPTGEIEQYSVSATYELQREDRALVDTLKFVTQAEGAKQTEATMT
FKYNRQSMTLSSEVQIPDFDVDLGTILRVNDESTEGKTSYRLTLDIQNKK
ITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAHWSPAKLLLQM
DSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDY
PKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQT
LQDHLNSLKEFNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPL
PFGGKSSRDLKMLETVRTPALHFKSVGFHLPSREFQVPTFTIPKLYQLQV
PLLGVLDLSTNVYSNLYNWSASYSGGNTSTDHFSLRARYHMKADSVVDLL
SYNVQGSGETTYDHKNTFTLSYDGSLRHKFLDSNIKFSHVEKLGNNPVSK
GLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGT
YGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDL
QSGIIKNTASLKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRS
EYQADYESLRFFSLLSGSLNSHGLELNADILGTDKINSGAHKATLRIGQD
GISTSATTNLKCSLLVLENELNAELGLSGASMKLTTNGRFREHNAKFSLD
GKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSNDMMGSYAEMK
FDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSD
LKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSAS
YKADTVAKVQGVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVM
APFTMTIDAHTNGNGKLALWGEHTGQLYSKFLLKAEPLAFTFSHDYKGST
SHHLVSRKSISAALEHKVSALLTPAEQTGTWKLKTQFNNNEYSQDLDAYN
TKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDALEMRDAVEKPQ
EFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLK
HINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYR
ITENDIQIALDDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHDLKIAIAN
IIDEIIEKLKSLDEHYHIRVNLVKTIHDLHLFIENIDFNKSGSSTASWIQ
NVDTKYQIRIQIQEKLQQLKRHIQNIDIQHLAGKLKQHIEAIDVRVLLDQ
LGTTISFERINDILEHVKHFVINLIGDFEVAEKINAFRAKVHELIERYEV
DQQIQVLMDKLVELAHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDA
VKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRL
NGEIQALELPQKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEAL
SSASLAHMKAKFRETLEDTRDRMYQMDIQQELQRYLSLVGQVYSTLVTYI
SDWWTLAAKNLTDFAEQYSIQDWAKRMKALVEQGFTVPEIKTILGTMPAF
EVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIKIPSRFSTPEF
TILNTFHIPSFTIDFVEMKVKIIRTIDQMLNSELQWPVPDIYLRDLKVED
IPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTI
EVPTFGKLYSILKIQSPLFTLDANADIGNGTTSANEAGIAASITAKGESK
LEVLNFDFQANAQLSNPKINPLALKESVKFSSKYLRTEHGSEMLFFGNAI
EGKSNTVASLHTEKNTLELSNGVIVKINNQLTLDSNTKYFHKLNIPKLDF
SSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEGTHESQISFTI
EGPLTSFGLSNKINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQHVGHS
VLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITAST
NNEGNLKVRFPLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQ
NFSAGNNENIMEAHVGINGEANLDFLNIPLTIPEMRLPYTIITTPPLKDF
SLWEKTGLKEFLKTTKQSFDLSVKAQYKKNKHRHSITNPLAVLCEFISQS
IKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHDELPRTFQIPG
YTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILP
SLELPVLHVPRNLKLSLPDFKELCTISHIFIPAMGNITYDFSFKSSVITL
NTNAELFNQSDIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALS
LSNKFVEGSHNSTVSLTTKNMEVSVATTTKAQIPILRMNFKQELNGNTKS
KPTVSSSMEFKYDFNSSMLYSTAKGAVDHKLSLESLTSYFSIESSTKGDV
KGSVLSREYSGTIASEANTYLNSKSTRSSVKLQGTSKIDDIWNLEVKENF
AGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALV
QVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVEL
SNDQEKAHLDIAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQ
HLRVSTAFVYTKNPNGYSFSIPVKVLADKFIIPGLKLNDLNSVLVMPTFH
VPFTDLQVPSCKLDFREIQIYKKLRTSSFALNLPTLPEVKFPEVDVLTKY
SQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDLNAVANKIADF
ELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSA
SLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTFA
HRDFSAEYEEDGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTS
AASPAVGTVGMDMDEDDDFSKWNFYYSPQSSPDKKLTIFKTELRVRESDE
ETQIKVNWEEEAASGLLTSLKDNVPKATGVLYDYVNKYHWEHTGLTLREV
SSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGTYQEWKDKAQN
LYQELLTQEGQASFQGLKDNVFDGLVRVTQEFHMKVKHLIDSLIDFLNFP
RFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVHNGSEILFSYFQDLV
ITLPFELRKHKLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQ
DLLQFIFQLIEDNIKQLKEMKFTYLINYIQDEINTIFSDYIPYVFKLLKE
NLCLNLHKFNEFIQNELQEASQELQQIHQYIMALREEYFDPSIVGWTVKY
YELEEKIVSLIKNLLVALKDFHSEYIVSASNFTSQLSSQVEQFLHRNIQE
YLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQ
DFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNP
YMKLAPGELTIIL

Задіяний у таких біологічних процесах як метаболізм ліпідів, транспорт, метаболізм холестеролу, транспорт ліпідів, метаболізм стероїдів, метаболізм стеролів. Білок має сайт для зв'язування з з молекулою гепарину. Локалізований у цитоплазмі. Також секретований назовні.

Білкові ізоформиРедагувати

Основний білок, який утворюється при експресії гену APOB має молекулярну масу близько 100 кДа, синтезується в печінці й відповідає за обмін ліпідів, перебуваючи у складі ліпопротеїдів великої і низької щільності в плазмі крові. Механізм редагування мРНК аполіпопротеїну B призводить до появи меншої ізоформи ApoB-48 (масою 48 кДа), яка секретується клітинами тонкого кишечнику.

Історія відкриттяРедагувати

Група американських вчених із Техасу досліджувала як саме один ген дає дві різні білкові ізоформи[6]. Перша ізоформа за амінокислотною послідовністю збігалася з теоретично передбаченою з нуклеотидів гену APOB, тоді як ApoB-48 хоча й мала антигенні властивості N-кінцевої ділянки першої, проте значно відрізнялася за функцією. Аналіз мРНК у печінці й кишечнику виявив наявність повних транскриптів гену ApoB, але в кишечнику цитозин у 6457 положенні було замінено на урацил. Така заміна в цьому місці перетворювала кодон ЦАА, що кодує амінокислоту глутамін, на триплет УАА, що є одним зі стоп-кодонів. Це призводило до припинення трансляції білку й утворення вкороченої молекули ApoB-48. Автори дослідження висунули гіпотезу про відкриття унікального механізму зміни транскрипції. У подальшому було описано цілу систему дезамінування цитозинів у мРНК після транскрипції.

Механізм редагування РНКРедагувати

Головним ферментом, який бере участь у редагуванні РНК шляхом дезамінування цитидину, в хребетних тварин є цитидиндезаміназа, яка кодується геном APOBEC1. Цей фермент редагує вже зрілі мРНК в ядрі. Для редагування необхідний білковий комплекс, до якого окрім APOBEC1 входить білок ACF (англ. apobec-1 complementation factor), допоміжний фактор APOBEC1 і ще деякі білки. Цей комплекс розпізнає ділянку РНК у 30-40 нуклеотидів, яка утворює шпильку, причому цільовий цитозин міститься в «голівці» (неспареній ділянці) цієї шпильки. Білок ACF виконує адапторну функцію, забезпечуючи контакт дезамінази з РНК. Комплекс розпізнає послідовність UUUN(A/U)U, яка має міститися далі за сайтом редагування та перетинається з якірною послідовністю, до якої приєднується молекула ACF.

мРНК аполіпопротеїну B є основною мішенню дії фермента APOBEC1, який експресується переважно у кишечнику людини та додатково у печінці інших видів ссавців.

ЛітератураРедагувати

  • Deeb S.S., Motulsky A.G., Albers J.J. (1985). A partial cDNA clone for human apolipoprotein B.. Proc. Natl. Acad. Sci. U.S.A. 82: 4983 — 4986.  PubMed DOI:10.1073/pnas.82.15.4983
  • Carlsson P., Darnfors C., Olofsson S.O., Bjursell G. (1986). Analysis of the human apolipoprotein B gene; complete structure of the B-74 region.. Gene 49: 29 — 51.  PubMed DOI:10.1016/0378-1119(86)90383-5
  • Hardman D.A., Protter A.A., Schilling J.W., Kane J.P. (1987). Carboxyl terminal analysis of human B-48 protein confirms the novel mechanism proposed for chain termination.. Biochem. Biophys. Res. Commun. 149: 1214 — 1219.  PubMed DOI:10.1016/0006-291X(87)90537-7
  • Hospattankar A.V., Higuchi K., Law S.W., Meglin N., Brewer H.B. Jr. (1987). Identification of a novel in-frame translational stop codon in human intestine apoB mRNA.. Biochem. Biophys. Res. Commun. 148: 279 — 285.  PubMed DOI:10.1016/0006-291X(87)91107-7
  • Dashti N., Lee D.M., Mok T. (1986). Apolipoprotein B is a calcium binding protein.. Biochem. Biophys. Res. Commun. 137: 493 — 499.  PubMed DOI:10.1016/0006-291X(86)91237-4
  • Zhao Y., McCabe J.B., Vance J., Berthiaume L.G. (2000). Palmitoylation of apolipoprotein B is required for proper intracellular sorting and transport of cholesteroyl esters and triglycerides.. Mol. Biol. Cell 11: 721 — 734.  PubMed DOI:10.1091/mbc.11.2.721

ПриміткиРедагувати

  1. Захворювання, генетично пов'язані з Аполіпопротеїн B переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:603 (англ.). Процитовано 30 січня 2017. 
  5. UniProt, P04114 (англ.). Процитовано 30 січня 2017. 
  6. Chen, SH and Habib, G and Yang, CY and Gu, ZW and Lee, BR and Weng, SA and Silberman and Cai, SJ and Deslypere, JP and Rosseneu, M and et, al. (1987). Apolipoprotein B-48 is the product of a messenger RNA with an organ-specific in-frame stop codon. Science 238 (4825): 363–366. doi:10.1126/science.3659919. 

Див. такожРедагувати