Відкрити головне меню

PTGS1 (англ. Prostaglandin-endoperoxide synthase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 599 амінокислот, а молекулярна маса — 68 686[5].

PTGS1
Pghs1.png
Ідентифікатори
Символи PTGS1, COX1, COX3, PCOX1, PES-1, PGG/HS, PGHS-1, PGHS1, PHS1, PTGHS, prostaglandin-endoperoxide synthase 1
Зовнішні ІД OMIM: 176805 MGI: 97797 HomoloGene: 743 GeneCards: PTGS1
шифр КФ 1.14.99.1
Реагує на сполуку
ацетилсаліцилова кислота, bromfenac, Диклофенак, fenoprofen, Флурбіпрофен, Ібупрофен, Кетопрофен, Кеторолак, meclofenamic acid, Мефенамінова кислота, Мелоксикам, Напроксен, Німесулід, oxaprozin, Парацетамол, Фенілбутазон, Піроксикам, suprofen[1]
Шаблон експресії
PBB GE PTGS1 205127 at fs.png

PBB GE PTGS1 205128 x at fs.png

PBB GE PTGS1 215813 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_008969
RefSeq (білок)
NP_032995
Локус (UCSC) Хр. 9: 122.37 – 122.4 Mb Хр. 2: 36.23 – 36.25 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFG
LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWE
FVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRI
LPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFF
AQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGK
LKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQ
LSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQE
YSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDV
IRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDAL
EFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFG
GEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL

Кодований геном білок за функціями належить до оксидоредуктаз, пероксидаз. Задіяний у таких біологічних процесах, як метаболізм жирних кислот, метаболізм ліпідів, біосинтез жирних кислот, біосинтез ліпідів, біосинтез простагландинів, метаболізм простагландинів, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом. Локалізований у мембрані, ендоплазматичному ретикулумі, мікросомах.

ЛітератураРедагувати

  • Yokoyama C., Tanabe T. (1989). Cloning of human gene encoding prostaglandin endoperoxide synthase and primary structure of the enzyme.. Biochem. Biophys. Res. Commun. 165: 888 — 894.  PubMed DOI:10.1016/S0006-291X(89)80049-X
  • Qin N., Zhang S.P., Reitz T.L., Mei J.M., Flores C.M. (2005). Cloning, expression, and functional characterization of human cyclooxygenase-1 splicing variants: evidence for intron 1 retention.. J. Pharmacol. Exp. Ther. 315: 1298 — 1305.  PubMed DOI:10.1124/jpet.105.090944
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Smith W.L., DeWitt D.L., Garavito R.M. (2000). Cyclooxygenases: structural, cellular, and molecular biology.. Annu. Rev. Biochem. 69: 145 — 182.  PubMed DOI:10.1146/annurev.biochem.69.1.145
  • Sostres C., Gargallo C.J., Lanas A. (2014). Aspirin, cyclooxygenase inhibition and colorectal cancer.. World J. Gastrointest. Pharmacol. Ther. 5: 40 — 49.  PubMed DOI:10.4292/wjgpt.v5.i1.40
  • Goodman J.E., Bowman E.D., Chanock S.J., Alberg A.J., Harris C.C. (2004). Arachidonate lipoxygenase (ALOX) and cyclooxygenase (COX) polymorphisms and colon cancer risk.. Carcinogenesis 25: 2467 — 2472.  PubMed DOI:10.1093/carcin/bgh260

ПриміткиРедагувати

Див. такожРедагувати