Відкрити головне меню

Ацетилхолінестераза

білок-кодуючий ген Homo Sapiens
(Перенаправлено з ACHE)

Ацетилхолінестераза (англ. Acetylcholinesterase (Cartwright blood group)) — білок, який кодується геном ACHE, розташованим у людини на довгому плечі 7-ї хромосоми.[5][6][7]Довжина поліпептидного ланцюга білка становить 614 амінокислот, а молекулярна маса — 67 796[8].

Ацетилхолінестераза
PBB Protein ACHE image.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ACHE, AChE, acetylhydrolase, acetylcholinesterase (Yt blood group), ACEE, ARN-YT, acetylcholinesterase (Cartwright blood group), true cholinesterase (dated synonym)
Зовнішні ІД MGI: 87876 HomoloGene: 543 GeneCards: ACHE
Пов'язані генетичні захворювання
Цукровий діабет 2-го типу[1]
Реагує на сполуку
donepezil, Галантамін, neostigmine, physostigmine, pralidoxime, pyridostigmine, rivastigmine, tacrine[2]
Шаблон експресії
PBB GE ACHE 205377 s at fs.png

PBB GE ACHE 205378 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001290010
NM_009599
RefSeq (білок)
NP_001276939
NP_033729
Локус (UCSC) Хр. 7: 100.89 – 100.9 Mb Хр. 5: 137.29 – 137.29 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRG
IRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVC
YQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIY
GGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPG
NVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSR
GLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAG
DFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQ
VSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLA
AQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEE
KIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLE
VRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL

Це фермент, що міститься в синапсах та каталізує гідроліз нейромедіатора ацетилхоліну до холіну і залишку оцтової кислоти. Реакція, що каталізується ацтилхолінестеразою, необхідна для дезактивації ацетилхоліну і переходу клітини клітини-мішені в стан спокою (наприклад, для розслаблення м'язової клітини). Тому інгібітори ацетилхолінестерази (фосфорорганічні інсектициди, зарин, зоман і V-гази, фасцикулін і деякі інші пептиди зміїних отрут) — потужні токсини, дія яких на організм людини зазвичай призводить до смерті від судом дихальної мускулатури.

Локалізований також у клітинній мембрані, ядрі, клітинних контактах, може бути секретований назовні.

Тетрамер ацетилхолінестерази, Mus musculus.

Зміст

Див. такожРедагувати

ПриміткиРедагувати

  1. Захворювання, генетично пов'язані з Ацетилхолінестераза переглянути/редагувати посилання на ВікіДаних. 
  2. Сполуки, які фізично взаємодіють з Acetylcholinesterase (Cartwright blood group) переглянути/редагувати посилання на ВікіДаних. 
  3. Human PubMed Reference:. 
  4. Mouse PubMed Reference:. 
  5. HUGO Gene Nomenclature Commitee, HGNC:108 (англ.). Процитовано 30 листопада 2018. 
  6. Ehrlich G, Viegas-Pequignot E, Ginzberg D, et al. (1992). Mapping the human acetylcholinesterase gene to chromosome 7q22 by fluorescent in situ hybridization coupled with selective PCR amplification from a somatic hybrid cell panel and chromosome-sorted DNA libraries.. Genomics 13 (4): 1192–7. PMID 1380483. doi:10.1016/0888-7543(92)90037-S. 
  7. Getman DK, Eubanks JH, Camp S, et al. (1992). The human gene encoding acetylcholinesterase is located on the long arm of chromosome 7.. Am. J. Hum. Genet. 51 (1): 170–7. PMID 1609795. 
  8. UniProt, P22303 (англ.). Процитовано 30 листопада 2018. 

ДжерелаРедагувати

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chhajlani V., Derr D., Earles B., Schmell E., August T. (1989). Purification and partial amino acid sequence analysis of human erythrocyte acetylcholinesterase.. FEBS Lett. 247: 279 — 282.  PubMed DOI:10.1016/0014-5793(89)81352-3
  • Yang L., He H.Y., Zhang X.J. (2002). Increased expression of intranuclear AChE involved in apoptosis of SK-N-SH cells.. Neurosci. Res. 42: 261 — 268.  PubMed DOI:10.1016/S0168-0102(02)00005-6
  • Felder C.E., Botti S.A., Lifson S., Silman I., Sussman J.L. (1997). External and internal electrostatic potentials of cholinesterase models.. J. Mol. Graph. Model. 15: 318 — 327.  PubMed DOI:10.1016/S1093-3263(98)00005-9
  • Bartels C.F., Zelinski T., Lockridge O. (1993). Mutation at codon 322 in the human acetylcholinesterase (ACHE) gene accounts for YT blood group polymorphism.. Am. J. Hum. Genet. 52: 928 — 936.  PubMed