Відкрити головне меню

АпоЕ-рецептор 2, АпоЕ рецептор 2 типу (англ. LDL receptor related protein 8, ApoER2) – білок, який кодується геном LRP8, розташованим у людини на короткому плечі 1-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 963 амінокислот, а молекулярна маса — 105 634[5]. Рецептор, що належить до родини рецепторів ліпопротеїнів низької щільності (англ. Low density lipoprotein receptor gene family) та виявляється переважно в мозку і плаценті. ApoER2 складається з п'яти функціональних доменів, подібно до інших білків своєї родини.

АпоЕ-рецептор 2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи LRP8, APOER2, HSZ75190, LRP-8, MCI1, low density lipoprotein receptor-related protein 8, LDL receptor related protein 8
Зовнішні ІД OMIM: 602600 MGI: 1340044 HomoloGene: 31250 GeneCards: LRP8
Пов'язані генетичні захворювання
myocardial infarction, susceptibility to[1]
Шаблон експресії
PBB GE LRP8 208433 s at fs.png

PBB GE LRP8 205282 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001018054
NM_004631
NM_017522
NM_033300
RefSeq (білок)
NP_001018064
NP_004622
NP_059992
NP_150643
Локус (UCSC) Хр. 1: 53.24 – 53.33 Mb Хр. 4: 107.8 – 107.88 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKD
QFQCRNERCIPSVWRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIH
ERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDG
EKDCEGGADEAGCATLCAPHEFQCGNRSCLAAVFVCDGDDDCGDGSDERG
CADPACGPREFRCGGDGGGACIPERWVCDRQFDCEDRSDEAAELCGRPGP
GATSAPAACATASQFACRSGECVHLGWRCDGDRDCKDKSDEADCPLGTCR
GDEFQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHI
CTDLKIGFECTCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCE
CYPGYEMDLLTKNCKAAAGKSPSLIFTNRHEVRRIDLVKRNYSRLIPMLK
NVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPKEQEVLIDEQLHSPE
GLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDPL
RGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYW
VDSKLHQLSSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEA
IFSANRLNGLEISILAENLNNPHDIVIFHELKQPRAPDACELSVQPNGGC
EYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLASTM
TRTVPATTRAPGTTVHRSTYQNHSTETPSLTAAVPSSVSVPRAPSISPST
LSPATSNHSQHYANEDSKMGSTVTAAVIGIIVPIVVIALLCMSGYLIWRN
WKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRP
LWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKS
KRVALSLEDDGLP

Задіяний у таких біологічних процесах, як ендоцитоз, альтернативний сплайсинг. Білок має сайт для зв'язування з іоном кальцію. Локалізований у клітинній мембрані, також секретований назовні.

ApoER2 здатний зв'язуватися з аполіпопротеїн E-вмісними ліпопротеїнами, але його основна виявлена функція — передача сигналу ріліну. Білок рілін, його рецептори ApoER2 і VLDLR, і адаптерний білок цитоплазми DAB1 є учасниками єдиного сигнального шляху, що регулюює правильну побудову шарів кори головного мозку. За відсутності обох рецепторів ApoER2 і VLDLR у мишей спостерігається фенотип reeler, такий же, як і за відсутності ріліну. ApoER2 грає важливішу роль в сигнальному шляху ріліну, оскільки при його відсутності спостерігаються серйозніші порушення міграції нейронів, чим за відсутності лише рецептора VLDLR.

Посилення довготривалої потенціації, що викликається ріліном, також опосередковано рецептором ApoER2. Внутріклітинний домен рецептора, що кодується екзоном 19, впливає на рецептор NMDA (NMDAR), що грає важливу роль в механізмах пам'яті і навчання. Точний механізм дії цього білка, проте, поки що невідомий. Передбачається, що ApoER2 утворює комплекси з NMDAR і білком PSD95. Екзон 19 схильний до альтернативному сплайсингу, причому відносна кількість рецепторів з екзоном 19 збільшується під час активності і зменшується під час сну. Відсутність екзона 19 у піддослідних мишей не порушує процес кортикогенезу, але приводить до порушення роботи пам'яті[6].

Див. такожРедагувати

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Sacre S.M., Stannard A.K., Owen J.S. (2003). Apolipoprotein E (apoE) isoforms differentially induce nitric oxide production in endothelial cells.. FEBS Lett. 540: 181 — 187.  PubMed DOI:10.1016/S0014-5793(03)00261-8
  • Andersen O.M., Benhayon D., Curran T., Willnow T.E. (2003). Differential binding of ligands to the apolipoprotein E receptor 2.. Biochemistry 42: 9355 — 9364.  PubMed DOI:10.1021/bi034475p
  • Li X., Kypreos K., Zanni E.E., Zannis V. (2003). Domains of apoE required for binding to apoE receptor 2 and to phospholipids: implications for the functions of apoE in the brain.. Biochemistry 42: 10406 — 10417.  PubMed DOI:10.1021/bi027093c
  • Riddell D.R., Vinogradov D.V., Stannard A.K., Chadwick N., Owen J.S. (1999). Identification and characterization of LRP8 (apoER2) in human blood platelets.. J. Lipid Res. 40: 1925 — 1930.  PubMed

ПриміткиРедагувати

  1. Захворювання, генетично пов'язані з АпоЕ-рецептор 2 переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:6700 (англ.). Процитовано 26 квітня 2018. 
  5. UniProt, Q14114 (англ.). Процитовано 26 квітня 2018. 
  6. Beffert U, Weeber EJ, Durudas A, Qiu S, Masiulis I, Sweatt JD, Li WP, Adelmann G, Frotscher M, Hammer RE, Herz J. Modulation of synaptic plasticity and memory by Reelin involves differential splicing of the lipoprotein receptor Apoer2. Neuron . 2005 Aug 18 ; 47(4):567-79. PMID 16102539 free full text PDF Архівовано 30 вересня 2007 у Wayback Machine.