TERF2

білок-кодуючий ген Homo Sapiens

TERF2 (англ. Telomeric repeat binding factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 542 амінокислот, а молекулярна маса — 59 594[4].

TERF2
Protein TERF2 PDB 1h6p.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TERF2, TRBF2, TRF2, telomeric repeat binding factor 2
Зовнішні ІД OMIM: 602027 MGI: 1195972 HomoloGene: 4133 GeneCards: TERF2
Шаблон експресії
PBB GE TERF2 203611 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005652
NM_001083118
NM_001286200
NM_009353
RefSeq (білок)
NP_005643
Локус (UCSC) Хр. 16: 69.36 – 69.41 Mb Хр. 8: 107.07 – 107.1 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSS
DGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLK
FYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLS
RIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVK
EAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPV
IQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDK
QPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKL
DQKDLVLPTQALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMT
ISRLVLEEDSQSTEPSAGLNSSQEAASAPPSKPTVLNQPLPGEKNPKVPK
GKWNSSNGVEEKETWVEEDELFQVQAAPDEDSTTNITKKQKWTVEESEWV
KAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Broccoli D., Smogorzewska A., Chong L., de Lange T. (1997). Human telomeres contain two distinct Myb-related proteins, TRF1 and TRF2.. Nat. Genet. 17: 231 — 235.  PubMed DOI:10.1038/ng1097-231
  • van Steensel B., Smogorzewska A., de Lange T. (1998). TRF2 protects human telomeres from end-to-end fusions.. Cell 92: 401 — 413.  PubMed DOI:10.1016/S0092-8674(00)80932-0
  • Zhu X.-D., Kuester B., Mann M., Petrini J.H.J., de Lange T. (2000). Cell-cycle-regulated association of RAD50/MRE11/NBS1 with TRF2 and human telomeres.. Nat. Genet. 25: 347 — 352.  PubMed DOI:10.1038/77139
  • Liu D., O'Connor M.S., Qin J., Songyang Z. (2004). Telosome, a mammalian telomere-associated complex formed by multiple telomeric proteins.. J. Biol. Chem. 279: 51338 — 51342.  PubMed DOI:10.1074/jbc.M409293200
  • de Lange T. (2005). Shelterin: the protein complex that shapes and safeguards human telomeres.. Genes Dev. 19: 2100 — 2110.  PubMed DOI:10.1101/gad.1346005

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11729 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q15554 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати