TERF1

білок-кодуючий ген Homo Sapiens

TERF1 (англ. Telomeric repeat binding factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 439 амінокислот, а молекулярна маса — 50 246[4].

TERF1
Protein TERF1 PDB 1ba5.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TERF1, PIN2, TRBF1, TRF, TRF1, hTRF1-AS, t-TRF1, telomeric repeat binding factor 1
Зовнішні ІД OMIM: 600951 MGI: 109634 HomoloGene: 7570 GeneCards: TERF1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003218
NM_017489
NM_001286628
NM_009352
RefSeq (білок)
NP_003209
NP_059523
NP_001273557
NP_033378
Локус (UCSC) Хр. 8: 73.01 – 73.05 Mb Хр. 1: 15.81 – 15.84 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQ
VGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRR
TRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITP
LESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERI
FGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSE
KSSTFLMKAAAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDK
QSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKK
KKESRRATESRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGE
GNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, поділ клітини, мітоз, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі, хромосомах.

ЛітератураРедагувати

  • Broccoli D., Smogorzewska A., Chong L., de Lange T. (1997). Human telomeres contain two distinct Myb-related proteins, TRF1 and TRF2.. Nat. Genet. 17: 231 — 235.  PubMed DOI:10.1038/ng1097-231
  • Shen M., Haggblom C., Vogt M., Hunter T., Lu K.P. (1997). Characterization and cell cycle regulation of the related human telomeric proteins Pin2 and TRF1 suggest a role in mitosis.. Proc. Natl. Acad. Sci. U.S.A. 94: 13618 — 13623.  PubMed DOI:10.1073/pnas.94.25.13618
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nakamura M., Zhen Zhou X., Kishi S., Ping Lu K. (2002). Involvement of the telomeric protein Pin2/TRF1 in the regulation of the mitotic spindle.. FEBS Lett. 514: 193 — 198.  PubMed DOI:10.1016/S0014-5793(02)02363-3
  • Cook B.D., Dynek J.N., Chang W., Shostak G., Smith S. (2002). Role for the related poly(ADP-Ribose) polymerases tankyrase 1 and 2 at human telomeres.. Mol. Cell. Biol. 22: 332 — 342.  PubMed DOI:10.1128/MCB.22.1.332-342.2002
  • Loayza D., De Lange T. (2003). POT1 as a terminal transducer of TRF1 telomere length control.. Nature 423: 1013 — 1018.  PubMed DOI:10.1038/nature01688

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11728 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P54274 (англ.). Процитовано 7 вересня 2017. 

Див. такожРедагувати