RYR3

білок-кодуючий ген Homo Sapiens

RYR3 (англ. Ryanodine receptor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 4 870 амінокислот, а молекулярна маса — 552 042[6].

RYR3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RYR3, RYR-3, ryanodine receptor 3
Зовнішні ІД OMIM: 180903 MGI: 99684 HomoloGene: 68151 GeneCards: RYR3
Пов'язані генетичні захворювання
атеросклероз, ВІЛ-заворювання[1]
Реагує на сполуку
Аденозинтрифосфат, кофеїн, dantrolene[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001036
NM_001243996
NM_177652
NM_001319156
RefSeq (білок)
NP_001027
NP_001230925
NP_001306085
Локус (UCSC) Хр. 15: 33.31 – 33.87 Mb Хр. 2: 112.46 – 113.05 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAEGGEGGEDEIQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFL
EPTSEAKYIPPDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGH
RTLLYGHAVLLRHSFSGMYLTCLTTSRSQTDKLAFDVGLREHATGEACWW
TIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSVSNGNIQVDASFMQT
LWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTDQNDSQHRRIF
YEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRAKSDTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGD
SVCFVQHIASGLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRC
QREESQAARIIRNTTALFSQFVSGNNRTAAPITLPIEEVLQTLQDLIAYF
QPPEEEMRHEDKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLNVYNSVAH
FAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSNNLDWLISKLD
RLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDI
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGV
AEGSAQYKKWYFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGW
GGNGVGDDLYSYGFDGLHLWSGRIPRAVASINQHLLRSDDVVSCCLDLGV
PSISFRINGQPVQGMFENFNTDGLFFPVMSFSAGVKVRFLMGGRHGEFKF
LPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGIRDLLGTTQFLSQASFI
PCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKK
VKLPKNYMMSNGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIK
QGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGYN
IEPSDQELADSAVEKVSIDKIRFFRVERSYAVRSGKWYFEFEVVTGGDMR
VGWARPGCRPDVELGADDQAFVFEGNRGQRWHQGSGYFGRTWQPGDVVGC
MINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKD
HPHIEVMRIDGTMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSF
SHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQDPSCVWVGWVTP
DYHLYSEKFDLNKNCTVTVTLGDERGRVHESVKRSNCYMVWGGDIVASSQ
RSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPNTKVFPAVFLQ
PTSTSLFQFELGKLKNAMPLSAAIFRSEEKNPVPQCPPRLDVQTIQPVLW
SRMPNSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCE
QEDLMRFHYHTLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPG
LLRSGFYDLLISIHLASAKERKLMMKNEYIIPITSTTRNIRLFPDESKRH
GLPGVGLRTCLKPGFRFSTPCFVVTGEDHQKQSPEIPLESLRTKALSMLT
EAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDDDDVRQILLLI
DPSVFGEHSAGTEEGAEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQ
ALNMSAALTARKTKEFRSPPQEQINMLLNFQLGENCPCPEEIREELYDFH
EDLLLHCGVPLEEEEEEEEDTSWTGKLCALVYKIKGPPKPEKEQPTEEEE
RCPTTLKELISQTMICWAQEDQIQDSELVRMMFNLLRRQYDSIGELLQAL
RKTYTISHTSVSDTINLLAALGQIRSLLSVRMGKEEELLMINGLGDIMNN
KVFYQHPNLMRVLGMHETVMEVMVNVLGTEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNEL
ALSLEEPDLEKVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLR
FAVFVNSESVEENASVVVKLLIRRPECFGPALRGEGGNGLLAAMQGAIKI
SENPALDLPSQGYKREVSTGDDEEEEEIVHMGNAIMSFYSALIDLLGRCA
PEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPSLNKDGSVSE
PDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLD
TVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIY
RLSKGRSLTKAQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYC
KMPLKLLTNHYEQCWKYYCLPSGWGSYGLAVEEELHLTEKLFWGIFDSLS
HKKYDPDLFRMALPCLSAIAGALPPDYLDTRITATLEKQISVDADGNFDP
KPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGISLDENVKT
HPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRE
NEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKK
KKLELESKGGGSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGIIVSR
GMKDMELDASSMEKRFAYKFLKKILKYVDSAQEFIAHLEAIVSSGKTEKS
PRDQEIKFFAKVLLPLVDQYFTSHCLYFLSSPLKPLSSSGYASHKEKEMV
AGLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTVMKSGSELVK
AGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPI
LTSIFEHVTQHQFGMDLLLGDVQISCYHILCSLYSLGTGKNIYVERQRPA
LGECLASLAAAIPVAFLEPTLNRYNPLSVFNTKTPRERSILGMPDTVEDM
CPDIPQLEGLMKEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGP
ENLPPSTGPCCTKVTSEHLSLILGNILKIINNNLGIDEASWMKRIAVYAQ
PIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLKADGKGDTQEAELL
ILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDADSDQLFRMVAEVFI
LWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQER
KKTKRRGDLYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSHR
DTDEEVREHLRNNLHLQEKSDDPAVKWQLNLYKDVLKSEEPFNPEKTVER
VQRISAAVFHLEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLP
RHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSPKVEEEEEEETEKQP
DPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEDEDK
EKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLK
LGIAILNGGNAGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFER
QNKAEGLGMVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNSDF
QNFLRTQMGNTTTVNVIISTVDYLLRLQESISDFYWYYSGKDIIDESGQH
NFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANM
QMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLV
ESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKKEFQKAMEG
QKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTN
LSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISE
SSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLAS
QISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVK
RNVTDFLKRATLKNLRKQYRNVKKMTAKELVKVLFSFFWMLFVGLFQLLF
TILGGIFQILWSTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDTMEA
ERAEVMEPGITTELVHFIKGEKGDTDIMSDLFGLHPKKEGSLKHGPEVGL
GDLSEIIGKDEPPTLESTVQKKRKAQAAEMKAANEAEGKVESEKADMEDG
EKEDKDKEEEQAEYLWTEVTKKKKRRCGQKVEKPEAFTANFFKGLEIYQT
KLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEETEDVANLWN
SFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKV
PLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYW
DKFVKRKVINKYGDLYGAERIAELLGLDKNALDFSPVEETKAEAASLVSW
LSSIDMKYHIWKLGVVFTDNSFLYLAWYTTMSVLGHYNNFFFAAHLLDIA
MGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSE
DDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMYRIVFD
ITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDY
FDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQER
CWDFFPAGDCFRKQYEDQLG

Кодований геном білок за функціями належить до рецепторів, іонних каналів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, транспорт кальцію, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою кальмодуліну, іоном кальцію. Локалізований у мембрані, ендоплазматичному ретикулумі, саркоплазматичному ретикулумі, мікросомах.

ЛітератураРедагувати

  • Leeb T., Brenig B. (1998). cDNA cloning and sequencing of the human ryanodine receptor type 3 (RYR3) reveals a novel alternative splice site in the RYR3 gene.. FEBS Lett. 423: 367 — 370.  PubMed DOI:10.1016/S0014-5793(98)00124-0
  • Martin C., Chapman K.E., Seckl J.R., Ashley R.H. (1998). Partial cloning and differential expression of ryanodine receptor/calcium-release channel genes in human tissues including the hippocampus and cerebellum.. Neuroscience 85: 205 — 216.  PubMed DOI:10.1016/S0306-4522(97)00612-X
  • Sorrentino V., Giannini G., Malzac P., Mattei M.-G. (1993). Localization of a novel ryanodine receptor gene (RYR3) to human chromosome 15q14-q15 by in situ hybridization.. Genomics 18: 163 — 165.  PubMed DOI:10.1006/geno.1993.1446
  • Lynn S., Morgan J.M., Lamb H.K., Meissner G., Gillespie J.I. (1995). Isolation and partial cloning of ryanodine-sensitive Ca2+ release channel protein isoforms from human myometrial smooth muscle.. FEBS Lett. 372: 6 — 12.  PubMed DOI:10.1016/0014-5793(95)00924-X
  • Schwarzmann N., Kunerth S., Weber K., Mayr G.W., Guse A.H. (2002). Knock-down of the type 3 ryanodine receptor impairs sustained Ca2+ signaling via the T cell receptor/CD3 complex.. J. Biol. Chem. 277: 50636 — 50642.  PubMed DOI:10.1074/jbc.M209061200
  • Yuchi Z., Lau K., Van Petegem F. (2012). Disease mutations in the ryanodine receptor central region: crystal structures of a phosphorylation hot spot domain.. Structure 20: 1201 — 1211.  PubMed DOI:10.1016/j.str.2012.04.015

ПриміткиРедагувати

Див. такожРедагувати