PROS1 (англ. Protein S (alpha)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 676 амінокислот, а молекулярна маса — 75 123[2].

PROS1
Ідентифікатори
Символи vitamin K-dependent plasma protein SPROS1protein Savitamin K-dependent protein Sprotein S (alpha)
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE PROS1 207808 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETK
QGNLERECIEELCNKEEAREVFENDPETDYFYPKYLVCLRSFQTGLFTAA
RQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKASFTCTCKPGWQ
GEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCK
DVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSEN
MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
YLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWL
LIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIA
KEAVMDINKPGPLFKPENGLLETKVYFAGFPRKVESELIKPINPRLDGCI
RSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNV
SSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDI
LLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDL
QRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLD
LDEAISKHNDIRAHSCPSVWKKTKNS

Задіяний у таких біологічних процесах як зсідання крові, гемостаз, фібриноліз, поліморфізм. Білок має сайт для зв'язування з іоном кальцію. Секретований назовні.

ЛітератураРедагувати

  • Ploos van Amstel H.K., van der Zanden A.L., Reitsma P.H., Bertina R.M. (1987). Human protein S cDNA encodes Phe-16 and Tyr 222 in consensus sequences for the post-translational processing.. FEBS Lett. 222: 186 — 190.  PubMed DOI:10.1016/0014-5793(87)80217-X
  • Hoskins J., Norman D.K., Beckmann R.J., Long G.L. (1987). Cloning and characterization of human liver cDNA encoding a protein S precursor.. Proc. Natl. Acad. Sci. U.S.A. 84: 349 — 353.  PubMed DOI:10.1073/pnas.84.2.349
  • Schmidel D.K., Tatro A.V., Phelps L.G., Tomczak J.A., Long G.L. (1990). Organization of the human protein S genes.. Biochemistry 29: 7845 — 7852.  PubMed DOI:10.1021/bi00486a010
  • Ploos van Amstel H.K., Reitsma P.H., der Logt C.P., Bertina R.M. (1990). Intron-exon organization of the active human protein S gene PS alpha and its pseudogene PS beta: duplication and silencing during primate evolution.. Biochemistry 29: 7853 — 7861.  PubMed DOI:10.1021/bi00486a011
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Li M., Long G.L. (1996). Identification of two novel point mutations in the human protein S gene associated with familial protein S deficiency and thrombosis.. Arterioscler. Thromb. Vasc. Biol. 16: 1407 — 1415.  PubMed DOI:10.1161/01.ATV.16.12.1407

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:9456 (англ.). Процитовано 30 серпня 2017. 
  2. UniProt, P07225 (англ.). Процитовано 30 серпня 2017. 

Див. такожРедагувати