Відкрити головне меню

PRMT1

білок-кодуючий ген Homo Sapiens

PRMT1 (англ. Protein arginine methyltransferase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 361 амінокислот, а молекулярна маса — 41 516[4].

PRMT1
Protein PRMT1 PDB 1or8.png
Ідентифікатори
Символи PRMT1, ANM1, HCP1, HRMT1L2, IR1B4, protein arginine methyltransferase 1
Зовнішні ІД OMIM: 602950 MGI: 107846 HomoloGene: 21477 GeneCards: PRMT1
шифр КФ 2.1.1.125
Шаблон експресії
PBB GE PRMT1 206445 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001207042
NM_001536
NM_198318
NM_198319
NM_001252476
NM_001252477
NM_019830
RefSeq (білок)
NP_001193971
NP_001527
NP_938074
NP_001239405
NP_001239406
NP_062804
Локус (UCSC) Хр. 19: 49.68 – 49.69 Mb Хр. 7: 44.98 – 44.99 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHF
GIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAG
ARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIII
SEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKD
YKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTV
KVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYT
HWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLC
ELSCSTDYRMR

Кодований геном білок за функціями належить до трансфераз, метилтрансфераз, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з S-аденозил-L-метіоніном. Локалізований у цитоплазмі, ядрі.

ЛітератураРедагувати

  • Nikawa J., Nakano H., Ohi N. (1996). Structural and functional conservation of human and yeast HCP1 genes which can suppress the growth defect of the Saccharomyces cerevisiae ire15 mutant.. Gene 171: 107 — 111.  PubMed DOI:10.1016/0378-1119(96)00073-X
  • Scorilas A., Black M.H., Talieri M., Diamandis E.P. (2000). Genomic organization, physical mapping, and expression analysis of the human protein arginine methyltransferase 1 gene.. Biochem. Biophys. Res. Commun. 278: 349 — 359.  PubMed DOI:10.1006/bbrc.2000.3807
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tang J., Kao P.N., Herschman H.R. (2000). Protein-arginine methyltransferase I, the predominant protein-arginine methyltransferase in cells, interacts with and is regulated by interleukin enhancer-binding factor 3.. J. Biol. Chem. 275: 19866 — 19876.  PubMed DOI:10.1074/jbc.M000023200
  • Miyata S., Mori Y., Tohyama M. (2008). PRMT1 and Btg2 regulates neurite outgrowth of Neuro2a cells.. Neurosci. Lett. 445: 162 — 165.  PubMed DOI:10.1016/j.neulet.2008.08.065
  • Pahlich S., Zakaryan R.P., Gehring H. (2008). Identification of proteins interacting with protein arginine methyltransferase 8: the Ewing sarcoma (EWS) protein binds independent of its methylation state.. Proteins 72: 1125 — 1137.  PubMed DOI:10.1002/prot.22004

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5187 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q99873 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати