Відкрити головне меню

PHF21A (англ. PHD finger protein 21A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 680 амінокислот, а молекулярна маса — 74 854[4].

PHF21A
Protein PHF21A PDB 2PUY.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PHF21A, BHC80, BM-006, PHD finger protein 21A
Зовнішні ІД OMIM: 608325 MGI: 2384756 HomoloGene: 9597 GeneCards: PHF21A
Шаблон експресії
PBB GE PHF21A 203278 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 11: 45.93 – 46.12 Mb Хр. 2: 92.09 – 92.36 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEK
QKRVVEQLRKNLIVKQEQPDKFQIQPLPQSENKLQTAQQQPLQQLQQQQQ
YHHHHAQQSAAASPNLTASQKTVTTASMITTKTLPLVLKAATATMPASVV
GQRPTIAMVTAINSQKAVLSTDVQNTPVNLQTSSKVTGPGAEAVQIVAKN
TVTLVQATPPQPIKVPQFIPPPRLTPRPNFLPQVRPKPVAQNNIPIAPAP
PPMLAAPQLIQRPVMLTKFTPTTLPTSQNSIHPVRVVNGQTATIAKTFPM
AQLTSIVIATPGTRLAGPQTVQLSKPSLEKQTVKSHTETDEKQTESRTIT
PPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVY
SGAVFEPERKKSAVTYLNSTMHPGTRKRGRPPKYNAVLGFGALTPTSPQS
SHPDSPENEKTETTFTFPAPVQPVSLPSPTSTDGDIHEDFCSVCRKSGQL
LMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIPWPGTLA
IVHSYIAYKAAKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEM
KNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCT
PPANAATSTPAPSPSSQSCTANCNQGEETK

Кодований геном білок за функціями належить до репресорів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hakimi M.-A., Dong Y., Lane W.S., Speicher D.W., Shiekhattar R. (2003). A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes.. J. Biol. Chem. 278: 7234 — 7239.  PubMed DOI:10.1074/jbc.M208992200

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:24156 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q96BD5 (англ.). Процитовано 8 вересня 2017. 

Див. такожРедагувати