Відкрити головне меню

ND4 (англ. NADH dehydrogenase, subunit 4 (complex I)) – білок, який кодується однойменним геном, який у людей є частиною мітохондріальної ДНК.[4] Довжина поліпептидного ланцюга білка становить 459 амінокислот, а молекулярна маса — 51 581[5].

ND4
Ідентифікатори
Символи ND4, MTMT-NADH dehydrogenase, subunit 4 (complex I)
Зовнішні ІД OMIM: 516003 MGI: 102498 HomoloGene: 38240 GeneCards: ND4
Пов'язані генетичні захворювання
Leber hereditary optic neuropathy, MELAS syndrome[1]
Шаблон експресії
PBB GE ND4 211600 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
NP_904337
Локус (UCSC) н/д н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLF
SCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLI
SLQISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFL
FYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYT
MAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLIL
NPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTA
ILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQT
LLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNM
LVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLN
PDIITGFSS

Кодований геном білок за функцією належить до оксидоредуктаз. Задіяний у таких біологічних процесах, як транспорт, транспорт електронів, дихальний ланцюг. Білок має сайт для зв'язування з НАД, убіхіноном. Локалізований у мембрані, мітохондрії.

ЛітератураРедагувати

  • Moilanen J.S., Finnila S., Majamaa K. (2003). Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J.. Mol. Biol. Evol. 20: 2132 — 2142.  PubMed DOI:10.1093/molbev/msg230
  • Ingman M., Kaessmann H., Paeaebo S., Gyllensten U. (2000). Mitochondrial genome variation and the origin of modern humans.. Nature 408: 708 — 713.  PubMed DOI:10.1038/35047064
  • Ingman M., Gyllensten U. (2003). Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines.. Genome Res. 13: 1600 — 1606.  PubMed DOI:10.1101/gr.686603
  • Brown W.M., Prager E.M., Wang A., Wilson A.C. (1982). Mitochondrial DNA sequences of primates: tempo and mode of evolution.. J. Mol. Evol. 18: 225 — 239.  PubMed DOI:10.1007/BF01734101
  • Majander A., Huoponen K., Savontaus M.-L., Nikoskelainen E., Wikstroem M. (1991). Electron transfer properties of NADH:ubiquinone reductase in the ND1/3460 and the ND4/11778 mutations of the Leber hereditary optic neuroretinopathy (LHON).. FEBS Lett. 292: 289 — 292.  PubMed DOI:10.1016/0014-5793(91)80886-8
  • Kormann B.A., Schuster H., Berninger T.A., Leo-Kottler B. (1991). Detection of the G to A mitochondrial DNA mutation at position 11778 in German families with Leber's hereditary optic neuropathy.. Hum. Genet. 88: 98 — 100.  PubMed DOI:10.1007/BF00204937

ПриміткиРедагувати

Див. такожРедагувати