MGA

білок-кодуючий ген Homo Sapiens

MGA (англ. MGA, MAX dimerization protein) – білок, який кодується однойменним геном, розташованим у людей на 15-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 3 026 амінокислот, а молекулярна маса — 331 836[4].

MGA
Ідентифікатори
Символи MGA, MAD5, MXD5, MAX dimerization protein, MAX dimerization protein MGA
Зовнішні ІД OMIM: 616061 MGI: 1352483 HomoloGene: 49351 GeneCards: MGA
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001080541
NM_001164273
NM_001164274
NM_013720
RefSeq (білок)
NP_001074010
NP_001157745
NP_001157746
NP_038748
Локус (UCSC) Хр. 15: 41.62 – 41.77 Mb Хр. 2: 119.9 – 119.97 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MEEKQQIILANQDGGTVAGAAPTFFVILKQPGNGKTDQGILVTNQDACAL
ASSVSSPVKSKGKICLPADCTVGGITVTLDNNSMWNEFYHRSTEMILTKQ
GRRMFPYCRYWITGLDSNLKYILVMDISPVDNHRYKWNGRWWEPSGKAEP
HVLGRVFIHPESPSTGHYWMHQPVSFYKLKLTNNTLDQEGHIILHSMHRY
LPRLHLVPAEKAVEVIQLNGPGVHTFTFPQTEFFAVTAYQNIQITQLKID
YNPFAKGFRDDGLNNKPQRDGKQKNSSDQEGNNISSSSGHRVRLTEGQGS
EIQPGDLDPLSRGHETSGKGLEKTSLNIKRDFLGFMDTDSALSEVPQLKQ
EISECLIASSFEDDSRVASPLDQNGSFNVVIKEEPLDDYDYELGECPEGV
TVKQEETDEETDVYSNSDDDPILEKQLKRHNKVDNPEADHLSSKWLPSSP
SGVAKAKMFKLDTGKMPVVYLEPCAVTRSTVKISELPDNMLSTSRKDKSS
MLAELEYLPTYIENSNETAFCLGKESENGLRKHSPDLRVVQKYPLLKEPQ
WKYPDISDSISTERILDDSKDSVGDSLSGKEDLGRKRTTMLKIATAAKVV
NANQNASPNVPGKRGRPRKLKLCKAGRPPKNTGKSLISTKNTPVSPGSTF
PDVKPDLEDVDGVLFVSFESKEALDIHAVDGTTEESSSLQASTTNDSGYR
ARISQLEKELIEDLKTLRHKQVIHPGLQEVGLKLNSVDPTMSIDLKYLGV
QLPLAPATSFPFWNLTGTNPASPDAGFPFVSRTGKTNDFTKIKGWRGKFH
SASASRNEGGNSESSLKNRSAFCSDKLDEYLENEGKLMETSMGFSSNAPT
SPVVYQLPTKSTSYVRTLDSVLKKQSTISPSTSYSLKPHSVPPVSRKAKS
QNRQATFSGRTKSSYKSILPYPVSPKQKYSHVILGDKVTKNSSGIISENQ
ANNFVVPTLDENIFPKQISLRQAQQQQQQQQGSRPPGLSKSQVKLMDLED
CALWEGKPRTYITEERADVSLTTLLTAQASLKTKPIHTIIRKRAPPCNND
FCRLGCVCSSLALEKRQPAHCRRPDCMFGCTCLKRKVVLVKGGSKTKHFQ
RKAAHRDPVFYDTLGEEAREEEEGIREEEEQLKEKKKRKKLEYTICETEP
EQPVRHYPLWVKVEGEVDPEPVYIPTPSVIEPMKPLLLPQPEVLSPTVKG
KLLTGIKSPRSYTPKPNPVIREEDKDPVYLYFESMMTCARVRVYERKKED
QRQPSSSSSPSPSFQQQTSCHSSPENHNNAKEPDSEQQPLKQLTCDLEDD
SDKLQEKSWKSSCNEGESSSTSYMHQRSPGGPTKLIEIISDCNWEEDRNK
ILSILSQHINSNMPQSLKVGSFIIELASQRKSRGEKNPPVYSSRVKISMP
SCQDQDDMAEKSGSETPDGPLSPGKMEDISPVQTDALDSVRERLHGGKGL
PFYAGLSPAGKLVAYKRKPSSSTSGLIQVASNAKVAASRKPRTLLPSTSN
SKMASSSGTATNRPGKNLKAFVPAKRPIAARPSPGGVFTQFVMSKVGALQ
QKIPGVSTPQTLAGTQKFSIRPSPVMVVTPVVSSEPVQVCSPVTAAVTTT
TPQVFLENTTAVTPMTAISDVETKETTYSSGATTTGVVEVSETNTSTSVT
STQSTATVNLTKTTGITTPVASVAFPKSLVASPSTITLPVASTASTSLVV
VTAAASSSMVTTPTSSLGSVPIILSGINGSPPVSQRPENAAQIPVATPQV
SPNTVKRAGPRLLHPNGQIVQLLPLHQLRGSNTQPNLQPVMFRNPGSVMG
IRLPAPSKPSETPPSSTSSSAFSVMNPVIQAVGSSSAVNVITQAPSLLSS
GASFVSQAGTLTLRISPPEPQSFASKTGSETKITYSSGGQPVGTASLIPL
QSGSFALLQLPGQKPVPSSILQHVASLQMKRESQNPDQKDETNSIKREQE
TKKVLQSEGEAVDPEANVIKQNSGAATSEETLNDSLEDRGDHLDEECLPE
EGCATVKPSEHSCITGSHTDQDYKDVNEEYGARNRKSSKEKVAVLEVRTI
SEKASNKTVQNLSKVQHQKLGDVKVEQQKGFDNPEENSSEFPVTFKEESK
FELSGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKHLKGPLTRKCVGA
SQECKKEADEQLIKETKTCQENSDVFQQEQGISDLLGKSGITEDARVLKT
ECDSWSRISNPSAFSIVPRRAAKSSRGNGHFQGHLLLPGEQIQPKQEKKG
GRSSADFTVLDLEEDDEDDNEKTDDSIDEIVDVVSDYQSEEVDDVEKNNC
VEYIEDDEEHVDIETVEELSEEINVAHLKTTAAHTQSFKQPSCTHISADE
KAAERSRKAPPIPLKLKPDYWSDKLQKEAEAFAYYRRTHTANERRRRGEM
RDLFEKLKITLGLLHSSKVSKSLILTRAFSEIQGLTDQADKLIGQKNLLT
RKRNILIRKVSSLSGKTEEVVLKKLEYIYAKQQALEAQKRKKKMGSDEFD
ISPRISKQQEGSSASSVDLGQMFINNRRGKPLILSRKKDQATENTSPLNT
PHTSANLVMTPQGQLLTLKGPLFSGPVVAVSPDLLESDLKPQVAGSAVAL
PENDDLFMMPRIVNVTSLATEGGLVDMGGSKYPHEVPDSKPSDHLKDTVR
NEDNSLEDKGRISSRGNRDGRVTLGPTQVFLANKDSGYPQIVDVSNMQKA
QEFLPKKISGDMRGIQYKWKESESRGERVKSKDSSFHKLKMKDLKDSSIE
MELRKVTSAIEEAALDSSELLTNMEDEDDTDETLTSLLNEIAFLNQQLND
DSVGLAELPSSMDTEFPGDARRAFISKVPPGSRATFQVEHLGTGLKELPD
VQGESDSISPLLLHLEDDDFSENEKQLAEPASEPDVLKIVIDSEIKDSLL
SNKKAIDGGKNTSGLPAEPESVSSPPTLHMKTGLENSNSTDTLWRPMPKL
APLGLKVANPSSDADGQSLKVMPCLAPIAAKVGSVGHKMNLTGNDQEGRE
SKVMPTLAPVVAKLGNSGASPSSAGK

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг, метилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:14010 (англ.). Процитовано 21 вересня 2017. 
  4. UniProt, Q8IWI9 (англ.). Процитовано 21 вересня 2017. 

Див. такожРедагувати