Відкрити головне меню

MET (англ. MET proto-oncogene, receptor tyrosine kinase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 1 390 амінокислот, а молекулярна маса — 155 541[6].

MET
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MET, MET proto-oncogene, receptor tyrosine kinase, AUTS9, HGFR, RCCP2, c-Met, DFNB97, OSFD
Зовнішні ІД MGI: 96969 HomoloGene: 206 GeneCards: MET
Пов'язані генетичні захворювання
Розсіяний склероз[1]
Реагує на сполуку
cabozantinib, crizotinib, tivantinib[2]
Шаблон експресії
PBB GE MET 211599 x at fs.png

PBB GE MET 213816 s at fs.png

PBB GE MET 203510 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000245
NM_001127500
NM_001324401
NM_001324402
NM_008591
RefSeq (білок)
NP_000236
NP_001120972
NP_001311330
NP_001311331
н/д
Локус (UCSC) Хр. 7: 116.67 – 116.8 Mb Хр. 6: 17.46 – 17.57 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAET
PIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQD
CSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNH
TADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNT
INSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYV
HAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSK
PDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNR
TLLRNSSGCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDL
TIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNG
YTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEE
CLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYS
TFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLK
SVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPT
KSFISGGSTITGVGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIIC
CTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPVFKPFEKPVMI
SMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLG
FFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNES
VDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNT
VHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDN
DGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSE
GSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWM
ALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGR
RLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYV
HVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS

Кодований геном білок за функціями належить до трансфераз, кіназ, рецепторів, тирозинових протеїнкіназ, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у мембрані. Також секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wang D., Li Z., Messing E.M., Wu G. (2002). Activation of Ras/Erk pathway by a novel MET-interacting protein RanBPM.. J. Biol. Chem. 277: 36216 — 36222.  PubMed DOI:10.1074/jbc.M205111200
  • Palka H.L., Park M., Tonks N.K. (2003). Hepatocyte growth factor receptor tyrosine kinase met is a substrate of the receptor protein-tyrosine phosphatase DEP-1.. J. Biol. Chem. 278: 5728 — 5735.  PubMed DOI:10.1074/jbc.M210656200
  • Wang D., Li Z., Schoen S.R., Messing E.M., Wu G. (2004). A novel MET-interacting protein shares high sequence similarity with RanBPM, but fails to stimulate MET-induced Ras/Erk signaling.. Biochem. Biophys. Res. Commun. 313: 320 — 326.  PubMed DOI:10.1016/j.bbrc.2003.11.124
  • Koch A., Mancini A., El Bounkari O., Tamura T. (2005). The SH2-domain-containing inositol 5-phosphatase (SHIP)-2 binds to c-Met directly via tyrosine residue 1356 and involves hepatocyte growth factor (HGF)-induced lamellipodium formation, cell scattering and cell spreading.. Oncogene 24: 3436 — 3447.  PubMed DOI:10.1038/sj.onc.1208558
  • Boccaccio C., Comoglio P.M. (2006). Invasive growth: a MET-driven genetic programme for cancer and stem cells.. Nat. Rev. Cancer 6: 637 — 645.  PubMed DOI:10.1038/nrc1912

ПриміткиРедагувати

Див. такожРедагувати