Відкрити головне меню

KIT (англ. KIT proto-oncogene receptor tyrosine kinase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 976 амінокислот, а молекулярна маса — 109 865[6].

KIT
Protein KIT PDB 1pkg.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIT, C-Kit, CD117, PBT, SCFR, KIT proto-oncogene receptor tyrosine kinase, MASTC, KIT proto-oncogene, receptor tyrosine kinase
Зовнішні ІД OMIM: 164920 MGI: 96677 HomoloGene: 187 GeneCards: KIT
Пов'язані генетичні захворювання
piebaldism, gastrointestinal stromal tumor, Гострий мієлоїдний лейкоз[1]
Реагує на сполуку
cediranib, crenolanib, linifanib, masitinib, pazopanib, semaxanib, сорафеніб, сунітиніб[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000222
NM_001093772
NM_001122733
NM_021099
RefSeq (білок)
NP_000213
NP_001087241
NP_001116205
NP_066922
Локус (UCSC) Хр. 4: 54.66 – 54.74 Mb Хр. 5: 75.57 – 75.66 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRV
GDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNK
HGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKG
CQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKF
ILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKREN
SQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIY
MNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVN
AAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRC
SASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKT
SAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQK
PMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNH
MNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEA
ALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIER
DVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILL
THGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFES
DVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPV
VDHSVRINSVGSTASSSQPLLVHDDV

Кодований геном білок за функціями належить до трансфераз, кіназ, рецепторів, тирозинових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, іонами металів, іоном магнію. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yamamoto K., Tojo A., Aoki N., Shibuya M. (1993). Characterization of the promoter region of the human c-kit proto-oncogene.. Jpn. J. Cancer Res. 84: 1136 — 1144.  PubMed DOI:10.1111/j.1349-7006.1993.tb02813.x
  • Blume-Jensen P., Wernstedt C., Heldin C.H., Ronnstrand L. (1995). Identification of the major phosphorylation sites for protein kinase C in kit/stem cell factor receptor in vitro and in intact cells.. J. Biol. Chem. 270: 14192 — 14200.  PubMed DOI:10.1074/jbc.270.23.14192
  • Linnekin D., DeBerry C.S., Mou S. (1997). Lyn associates with the juxtamembrane region of c-Kit and is activated by stem cell factor in hematopoietic cell lines and normal progenitor cells.. J. Biol. Chem. 272: 27450 — 27455.  PubMed DOI:10.1074/jbc.272.43.27450
  • Thommes K., Lennartsson J., Carlberg M., Ronnstrand L. (1999). Identification of Tyr-703 and Tyr-936 as the primary association sites for Grb2 and Grb7 in the c-Kit/stem cell factor receptor.. Biochem. J. 341: 211 — 216.  PubMed DOI:10.1042/bj3410211
  • Mancini A., Koch A., Stefan M., Niemann H., Tamura T. (2000). The direct association of the multiple PDZ domain containing proteins (MUPP-1) with the human c-Kit C-terminus is regulated by tyrosine kinase activity.. FEBS Lett. 482: 54 — 58.  PubMed DOI:10.1016/S0014-5793(00)02036-6

ПриміткиРедагувати

Див. такожРедагувати