Відкрити головне меню

H2AFX (англ. H2A histone family member X) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 143 амінокислот, а молекулярна маса — 15 145[4].

H2AFX
Protein H2AFX PDB 1aoi.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи H2AFX, H2A.X, H2A/X, H2AX, H2A histone family member X
Зовнішні ІД OMIM: 601772 MGI: 102688 HomoloGene: 134201 GeneCards: H2AFX
Шаблон експресії
PBB GE DPAGT1 212525 s at fs.png

PBB GE H2AFX 205436 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002105
NM_010436
RefSeq (білок)
NP_002096
NP_034566
Локус (UCSC) Хр. 11: 119.09 – 119.1 Mb Хр. 9: 44.33 – 44.34 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPV
YLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGG
VTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, клітинний цикл, пошкодження ДНК, репарація ДНК, Рекомбінація ДНК, мейоз, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.

ЛітератураРедагувати

  • Mannironi C., Bonner W.M., Hatch C.L. (1989). H2A.X. a histone isoprotein with a conserved C-terminal sequence, is encoded by a novel mRNA with both DNA replication type and polyA 3' processing signals.. Nucleic Acids Res. 17: 9113 — 9126.  PubMed DOI:10.1093/nar/17.22.9113
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rogakou E.P., Pilch D.R., Orr A.H., Ivanova V.S., Bonner W.M. (1998). DNA double-stranded breaks induce histone H2AX phosphorylation on serine 139.. J. Biol. Chem. 273: 5858 — 5868.  PubMed DOI:10.1074/jbc.273.10.5858
  • Rogakou E.P., Boon C., Redon C., Bonner W.M. (1999). Megabase chromatin domains involved in DNA double-strand breaks in vivo.. J. Cell Biol. 146: 905 — 916.  PubMed DOI:10.1083/jcb.146.5.905
  • Rogakou E.P., Nieves-Neira W., Boon C., Pommier Y., Bonner W.M. (2000). Initiation of DNA fragmentation during apoptosis induces phosphorylation of H2AX histone at serine 139.. J. Biol. Chem. 275: 9390 — 9395.  PubMed DOI:10.1074/jbc.275.13.9390
  • Ward I.M., Chen J. (2001). Histone H2AX is phosphorylated in an ATR-dependent manner in response to replicational stress.. J. Biol. Chem. 276: 47759 — 47762.  PubMed DOI:10.1074/jbc.C100569200

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4739 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, P16104 (англ.). Процитовано 8 вересня 2017. 

Див. такожРедагувати