GTF2I

білок-кодуючий ген Homo Sapiens

GTF2I (англ. General transcription factor IIi) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 998 амінокислот, а молекулярна маса — 112 416[4].

GTF2I
Protein GTF2I PDB 1q60.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GTF2I, BAP135, BTKAP1, DIWS, GTFII-I, IB291, SPIN, TFII-I, WBS, WBSCR6, general transcription factor IIi
Зовнішні ІД OMIM: 601679 MGI: 1202722 HomoloGene: 7748 GeneCards: GTF2I
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 7: 74.65 – 74.76 Mb Хр. 5: 134.24 – 134.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVY
ETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQAN
RMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVV
QGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVM
VTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQ
YNIQAGPSETDDVDEKQPLSKPLQGSHHSSEGNEGTEMEVPAEDSTQHVP
SETSEDPEVEVTIEDDDYSPPSKRPKANELPQPPVPEPANAGKRKVREFN
FEKWNARITDLRKQVEELFERKYAQAIKAKGPVTIPYPLFQSHVEDLYVE
GLPEGIPFRRPSTYGIPRLERILLAKERIRFVIKKHELLNSTREDLQLDK
PASGVKEEWYARITKLRKMVDQLFCKKFAEALGSTEAKAVPYQKFEAHPN
DLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKRPELLTHSTTE
VTQPRTNTPVKEDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVF
ESNPEFLYVEGLPEGIPFRSPTWFGIPRLERIVRGSNKIKFVVKKPELVI
SYLPPGMASKINTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNNPQTSA
VRTPTQTNGSNVPFKPRGREFSFEAWNAKITDLKQKVENLFNEKCGEALG
LKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAK
IKFIIKKPEMFETAIKESTSSKSPPRKINSSPNVNTTASGVEDLNIIQVT
IPDDDNERLSKVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITIN
PGCVVVDGMPPGVSFKAPSYLEISSMRRILDSAEFIKFTVIRPFPGLVIN
NQLVDQSESEGPVIQESAEPSQLEVPATEEIKETDGSSQIKQEPDPTW

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

ЛітератураРедагувати

  • Yang W., Desiderio S. (1997). BAP-135, a target for Bruton's tyrosine kinase in response to B cell receptor engagement.. Proc. Natl. Acad. Sci. U.S.A. 94: 604 — 609.  PubMed DOI:10.1073/pnas.94.2.604
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Egloff A.M., Desiderio S. (2001). Identification of phosphorylation sites for Bruton's tyrosine kinase within the transcriptional regulator BAP/TFII-I.. J. Biol. Chem. 276: 27806 — 27815.  PubMed DOI:10.1074/jbc.M103692200
  • Gocke C.B., Yu H., Kang J. (2005). Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.. J. Biol. Chem. 280: 5004 — 5012.  PubMed DOI:10.1074/jbc.M411718200
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4659 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P78347 (англ.). Процитовано 7 вересня 2017. 

Див. такожРедагувати