Відкрити головне меню

GRIA4 (англ. Glutamate ionotropic receptor AMPA type subunit 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 902 амінокислот, а молекулярна маса — 100 871[6].

GRIA4
Ідентифікатори
Символи GRIA4, GLUR4, GLUR4C, GLURD, GluA4, glutamate ionotropic receptor AMPA type subunit 4, NEDSGA
Зовнішні ІД OMIM: 138246 MGI: 95811 HomoloGene: 20227 GeneCards: GRIA4
Пов'язані генетичні захворювання
Аметропія[1]
Реагує на сполуку
AMPA, Анірацетам, cx516, CX546, Циклотіазид, IDRA-21, Пірацетам, S-18986, GYKI 53655, GYKI-52,466, NBQX, Тезампанел, Аргіотоксин 636, Токсин Джоро[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000829
NM_001077243
NM_001077244
NM_001112812
NM_001113180
NM_001113181
NM_019691
RefSeq (білок)
NP_000820
NP_001070711
NP_001070712
NP_001106283
NP_001106651
NP_001106652
NP_062665
Локус (UCSC) Хр. 11: 105.61 – 105.98 Mb Хр. 9: 4.42 – 4.8 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFL
HNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDK
RSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYE
WNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEE
LDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLE
RFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLK
QVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQ
DVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDL
ASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAP
LTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMC
IVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAE
PSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLD
SKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDS
GSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLT
FSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP

Кодований геном білок за функціями належить до рецепторів, іонних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних контактах, клітинних відростках, синапсах.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

Див. такожРедагувати