Відкрити головне меню

GRIA1 (англ. Glutamate ionotropic receptor AMPA type subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 906 амінокислот, а молекулярна маса — 101 506[6].

GRIA1
Ідентифікатори
Символи GRIA1, GLUH1, GLUR1, GLURA, GluA1, HBGR1, glutamate ionotropic receptor AMPA type subunit 1, Glutamate receptor, ionotropic, AMPA 1
Зовнішні ІД OMIM: 138248 MGI: 95808 HomoloGene: 20226 GeneCards: GRIA1
Пов'язані генетичні захворювання
Ожиріння[1]
Реагує на сполуку
AMPA, Анірацетам, cx516, CX546, Циклотіазид, IDRA-21, Пірацетам, S-18986, GYKI 53655, GYKI-52,466, NBQX, Тезампанел, Аргіотоксин 636, Токсин Джоро[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001113325
NM_001252403
NM_008165
RefSeq (білок)
NP_001106796
NP_001239332
NP_032191
Локус (UCSC) Хр. 5: 153.49 – 153.81 Mb Хр. 11: 57.01 – 57.33 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLT
EPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSF
CGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHYKWQKFVYIYD
ADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLV
VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANV
TGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLT
GNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGD
NSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHV
GYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVRE
EVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGV
SVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESA
EDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTT
EEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT
PKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSA
LSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSI
NEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL

Кодований геном білок за функціями належить до рецепторів, іонних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, поліморфізм, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних контактах, ендоплазматичному ретикулумі, клітинних відростках, синапсах.

ЛітератураРедагувати

  • Potier M.-C., Spillantini M.G., Carter N.P. (1992). The human glutamate receptor cDNA GluR1: cloning, sequencing, expression and localization to chromosome 5.. DNA Seq. 2: 211 — 218.  PubMed DOI:10.3109/10425179209020805
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

Див. такожРедагувати