Відкрити головне меню

GABRA5 (англ. Gamma-aminobutyric acid type A receptor alpha5 subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 462 амінокислот, а молекулярна маса — 52 146[5].

GABRA5
Ідентифікатори
Символи GABRA5, gamma-aminobutyric acid type A receptor alpha5 subunit
Зовнішні ІД MGI: 95617 HomoloGene: 20219 GeneCards: GABRA5
Реагує на сполуку
gaboxadol, isonipecotic acid, isoguvacine, muscimol, ZK93423, flumazenil, ZK93426, bretazenil, L-822179, methyl 6,7-dimethoxy-4-ethyl-β-carboline-3-carboxylate, Ro-15-4513, RO4938581, L-838417, ocinaplon, Алпразолам, flunitrazepam, triazolam, bicuculline, picrotoxin, CGS8216[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000810
NM_001165037
NM_176942
NM_001362161
NM_001362162
RefSeq (білок)
NP_000801
NP_001158509
NP_795916
NP_001349090
NP_001349091
Локус (UCSC) Хр. 15: 26.87 – 26.95 Mb Хр. 7: 57.41 – 57.51 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDNGMFSGFIMIKNLLLFCISMNLSSHFGFSQMPTSSVKDETNDNITIFT
RILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFF
RQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPN
KLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSE
VVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAH
FHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM
TTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWA
WDGKKALEAAKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNT
TSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYWATYLN
REPVIKGAASPK

Кодований геном білок за функціями належить до рецепторів, іонних каналів, хлорних каналів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт. Білок має сайт для зв'язування з хлоридом. Локалізований у клітинній мембрані, мембрані, клітинних контактах, синапсах.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kim Y., Glatt H., Xie W., Sinnett D., Lalande M. (1997). Human gamma-aminobutyric acid-type A receptor alpha5 subunit gene (GABRA5): characterization and structural organization of the 5' flanking region.. Genomics 42: 378 — 387.  PubMed DOI:10.1006/geno.1997.4770
  • Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D. (2007). Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry.. Proteomics 7: 868 — 874.  PubMed DOI:10.1002/pmic.200600410

ПриміткиРедагувати

Див. такожРедагувати