Відкрити головне меню

GABRA3

білок-кодуючий ген Homo Sapiens

GABRA3 (англ. Gamma-aminobutyric acid type A receptor alpha3 subunit) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[4] Довжина поліпептидного ланцюга білка становить 492 амінокислот, а молекулярна маса — 55 165[5].

GABRA3
Ідентифікатори
Символи GABRA3, gamma-aminobutyric acid type A receptor alpha3 subunit
Зовнішні ІД OMIM: 305660 MGI: 95615 HomoloGene: 20218 GeneCards: GABRA3
Реагує на сполуку
gaboxadol, isonipecotic acid, isoguvacine, muscimol, ZK93423, flumazenil, ZK93426, bretazenil, L-822179, methyl 6,7-dimethoxy-4-ethyl-β-carboline-3-carboxylate, Ro-15-4513, RO4938581, L-838417, ocinaplon, Алпразолам, Клоназепам, Діазепам, flunitrazepam, triazolam, Золпідем, bicuculline, picrotoxin, CGS8216[1]
Шаблон експресії
PBB GE GABRA3 207210 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000808
NM_008067
NM_001357814
NM_001357815
NM_001357816
NM_001358103
RefSeq (білок)
NP_000799
NP_032093
NP_001344743
NP_001344744
NP_001344745
NP_001345032
Локус (UCSC) Хр. X: 152.17 – 152.45 Mb Хр. X: 72.43 – 72.66 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MIITQTSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSP
KHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVT
SFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPD
TFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTMRLTIHAECPMHLEDFPM
DVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVV
GTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVF
SALIEFATVNYFTKRSWAWEGKKVPEALEMKKKTPAAPAKKTSTTFNIVG
TTYPINLAKDTEFSTISKGAAPSASSTPTIIASPKATYVQDSPTETKTYN
SVSKVDKISRIIFPVLFAIFNLVYWATYVNRESAIKGMIRKQ

Кодований геном білок за функціями належить до рецепторів, іонних каналів, хлорних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт. Білок має сайт для зв'язування з хлоридом. Локалізований у клітинній мембрані, мембрані, клітинних контактах, синапсах.

ЛітератураРедагувати

ПриміткиРедагувати

Див. такожРедагувати