Відкрити головне меню

GABRA2 (англ. Gamma-aminobutyric acid type A receptor alpha2 subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 451 амінокислот, а молекулярна маса — 51 326[5].

GABRA2
Ідентифікатори
Символи GABRA2, gamma-aminobutyric acid type A receptor alpha2 subunit
Зовнішні ІД OMIM: 137140 MGI: 95614 HomoloGene: 20217 GeneCards: GABRA2
Реагує на сполуку
gaboxadol, isonipecotic acid, isoguvacine, muscimol, ZK93423, flumazenil, ZK93426, bretazenil, L-822179, methyl 6,7-dimethoxy-4-ethyl-β-carboline-3-carboxylate, Ro-15-4513, RO4938581, L-838417, ocinaplon, Алпразолам, Клоназепам, Діазепам, flunitrazepam, triazolam, Золпідем, bicuculline, picrotoxin, CGS8216[1]
Шаблон експресії
PBB GE GABRA2 207014 at fs.png

PBB GE GABRA2 216039 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000807
NM_001114175
NM_001286827
NM_001330690
NM_008066
RefSeq (білок)
NP_000798
NP_001107647
NP_001273756
NP_001317619
NP_032092
Локус (UCSC) Хр. 4: 46.25 – 46.48 Mb Хр. 5: 70.96 – 71.1 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLL
DGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDE
RLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQD
DGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTY
NASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKI
GYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVV
NDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKP
ENKPAEAKKTFNSVSKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLGVS
P

Кодований геном білок за функціями належить до рецепторів, іонних каналів, хлорних каналів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, альтернативний сплайсинг. Білок має сайт для зв'язування з хлоридом. Локалізований у клітинній мембрані, мембрані, клітинних контактах, цитоплазматичних везикулах, синапсах.

ЛітератураРедагувати

ПриміткиРедагувати

Див. такожРедагувати