Відкрити головне меню

GABRA1 (англ. Gamma-aminobutyric acid type A receptor alpha1 subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 456 амінокислот, а молекулярна маса — 51 802[5].

GABRA1
Ідентифікатори
Символи GABRA1, ECA4, EIEE19, EJM, EJM5, gamma-aminobutyric acid type A receptor alpha1 subunit
Зовнішні ІД OMIM: 137160 MGI: 95613 HomoloGene: 629 GeneCards: GABRA1
Реагує на сполуку
gaboxadol, isonipecotic acid, isoguvacine, muscimol, ZK93423, flumazenil, L-838417, ZK93426, bretazenil, indiplon, ocinaplon, L-822179, methyl 6,7-dimethoxy-4-ethyl-β-carboline-3-carboxylate, Ro-15-4513, RO4938581, Алпразолам, Клоназепам, Діазепам, flunitrazepam, Золпідем, triazolam, bicuculline, picrotoxin, CGS8216[1]
Шаблон експресії
PBB GE GABRA1 206678 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_010250
NM_001359035
RefSeq (білок)
NP_000797
NP_001121115
NP_001121116
NP_001121117
NP_001121120
NP_034380
NP_001345964
Локус (UCSC) Хр. 5: 161.85 – 161.9 Mb Хр. 11: 42.13 – 42.18 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLL
DGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDE
RLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITE
DGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTR
EPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKI
GYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVV
PEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEV
KPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREPQLK
APTPHQ

Кодований геном білок за функціями належить до рецепторів, іонних каналів, хлорних каналів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт. Білок має сайт для зв'язування з хлоридом. Локалізований у клітинній мембрані, мембрані, клітинних контактах, цитоплазматичних везикулах, синапсах.

ЛітератураРедагувати

  • Schofield P.R., Pritchett D.B., Sontheimer H., Kettenmann H., Seeburg P.H. (1989). Sequence and expression of human GABAA receptor alpha 1 and beta 1 subunits.. FEBS Lett. 244: 361 — 364.  PubMed DOI:10.1016/0014-5793(89)80563-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

Див. такожРедагувати