Відкрити головне меню

FGFR3 (англ. Fibroblast growth factor receptor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 806 амінокислот, а молекулярна маса — 87 710[5].

FGFR3
PDB 1ry7 EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FGFR3, ACH, CD333, CEK2, HSFGFR3EX, JTK4, fibroblast growth factor receptor 3
Зовнішні ІД MGI: 95524 HomoloGene: 55437 GeneCards: FGFR3
Реагує на сполуку
Nintedanib[1]
Шаблон експресії
PBB GE FGFR3 204380 s at fs.png

PBB GE FGFR3 204379 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000142
NM_001163213
NM_022965
NM_001354809
NM_001354810
RefSeq (білок)
NP_000133
NP_001156685
NP_075254
NP_001341738
NP_001341739
н/д
Локус (UCSC) Хр. 4: 1.79 – 1.81 Mb Хр. 5: 33.72 – 33.74 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLV
FGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNAS
HEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGA
PYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHR
IGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSP
HRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHH
SAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRS
PPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPT
LANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAA
KPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGP
LYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKK
TTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPV
EELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDR
VLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPS
SGGSRT

Кодований геном білок за функціями належить до трансфераз, кіназ, рецепторів, тирозинових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у клітинній мембрані, мембрані, ендоплазматичному ретикулумі, цитоплазматичних везикулах. Також секретований назовні.

ЛітератураРедагувати

  • Keegan K., Johnson D.E., Williams L.T., Hayman M.J. (1991). Isolation of an additional member of the fibroblast growth factor receptor family, FGFR-3.. Proc. Natl. Acad. Sci. U.S.A. 88: 1095 — 1099.  PubMed DOI:10.1073/pnas.88.4.1095
  • Partanen J., Maekelae T.P., Alitalo R., Lehvaeslaiho H., Alitalo K. (1990). Putative tyrosine kinases expressed in K-562 human leukemia cells.. Proc. Natl. Acad. Sci. U.S.A. 87: 8913 — 8917.  PubMed DOI:10.1073/pnas.87.22.8913
  • Scotet E., Houssaint E. (1995). The choice between alternative IIIb and IIIc exons of the FGFR-3 gene is not strictly tissue-specific.. Biochim. Biophys. Acta 1264: 238 — 242.  PubMed DOI:10.1016/0167-4781(95)00156-B
  • Monsonego-Ornan E., Adar R., Feferman T., Segev O., Yayon A. (2000). The transmembrane mutation G380R in fibroblast growth factor receptor 3 uncouples ligand-mediated receptor activation from down-regulation.. Mol. Cell. Biol. 20: 516 — 522.  PubMed DOI:10.1128/MCB.20.2.516-522.2000
  • Hart K.C., Robertson S.C., Donoghue D.J. (2001). Identification of tyrosine residues in constitutively activated fibroblast growth factor receptor 3 involved in mitogenesis, Stat activation, and phosphatidylinositol 3-kinase activation.. Mol. Biol. Cell 12: 931 — 942.  PubMed DOI:10.1091/mbc.12.4.931
  • Monsonego-Ornan E., Adar R., Rom E., Yayon A. (2002). FGF receptors ubiquitylation: dependence on tyrosine kinase activity and role in downregulation.. FEBS Lett. 528: 83 — 89.  PubMed DOI:10.1016/S0014-5793(02)03255-6

ПриміткиРедагувати

Див. такожРедагувати