Відкрити головне меню

Фактор зсідання крові XI

білок-кодуючий ген Homo Sapiens
(Перенаправлено з F11)

F11 (англ. Coagulation factor XI) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 625 амінокислот, а молекулярна маса — 70 109[4].

F11
Protein F11 PDB 1xx9.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи F11, FXI, coagulation factor XI, PTA
Зовнішні ІД OMIM: 264900 MGI: 99481 HomoloGene: 86654 GeneCards: F11
Шаблон експресії
PBB GE F11 206610 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000128
NM_019559
NM_001354804
NM_028066
RefSeq (білок)
NP_000119
NP_001341733
NP_082342
Локус (UCSC) Хр. 4: 186.27 – 186.29 Mb Хр. 8: 45.24 – 45.26 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVC
TYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSF
KQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFT
YATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLAC
IRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKES
QRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTD
FLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKL
SSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWP
WQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILN
QSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPIC
LPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYR
GHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCA
QRERPGVYTNVVEYVDWILEKTQAV

Кодований геном білок за функціями належить до гідролаз, протеаз, серинових протеаз. Задіяний у таких біологічних процесах як зсідання крові, гемостаз, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з з молекулою гепарину. Секретований назовні.

ЛітератураРедагувати

  • Fujikawa K., Chung D.W., Hendrickson L.E., Davie E.W. (1986). Amino acid sequence of human factor XI, a blood coagulation factor with four tandem repeats that are highly homologous with plasma prekallikrein.. Biochemistry 25: 2417 — 2424.  PubMed DOI:10.1021/bi00357a018
  • Asakai R., Davie E.W., Chung D.W. (1987). Organization of the gene for human factor XI.. Biochemistry 26: 7221 — 7228.  PubMed DOI:10.1021/bi00397a004
  • Hsu T.-C., Shore S.K., Seshsmma T., Bagasra O., Walsh P.N. (1998). Molecular cloning of platelet factor XI, an alternative splicing product of the plasma factor XI gene.. J. Biol. Chem. 273: 13787 — 13793.  PubMed DOI:10.1074/jbc.273.22.13787
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • McMullen B.A., Fujikawa K., Davie E.W. (1991). Location of the disulfide bonds in human coagulation factor XI: the presence of tandem apple domains.. Biochemistry 30: 2056 — 2060.  PubMed DOI:10.1021/bi00222a008
  • Badellino K.O., Walsh P.N. (2001). Localization of a heparin binding site in the catalytic domain of factor XIa.. Biochemistry 40: 7569 — 7580.  PubMed DOI:10.1021/bi0027433

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3529 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P03951 (англ.). Процитовано 30 серпня 2017. 

Див. такожРедагувати