Відкрити головне меню

CYP3A5 (англ. Cytochrome P450 family 3 subfamily A member 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 502 амінокислот, а молекулярна маса — 57 109[5].

CYP3A5
Ідентифікатори
Символи CYP3A5, CP35, CYPIIIA5, P450PCN3, PCN3, cytochrome P450 family 3 subfamily A member 5
Зовнішні ІД OMIM: 605325 MGI: 106099 HomoloGene: 133568 GeneCards: CYP3A5
Реагує на сполуку
Ритонавір[1]
Шаблон експресії
PBB GE CYP3A5 214234 s at fs.png

PBB GE CYP3A5 205765 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000777
NM_001190484
NM_001291829
NM_001291830
NM_007820
RefSeq (білок)
NP_000768
NP_001177413
NP_001278758
NP_001278759
NP_031846
Локус (UCSC) Хр. 7: 99.65 – 99.68 Mb Хр. 5: 145.44 – 145.47 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNV
LSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYS
VFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIA
QYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQ
DPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLS
KSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAV
VQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYA
LHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFALMN
MKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDGTLS
GE

Кодований геном білок за функцією належить до оксидоредуктаз. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом. Локалізований у мембрані, ендоплазматичному ретикулумі, мікросомах.

ЛітератураРедагувати

  • Schuetz J.D., Molowa D.T., Guzelian P.S. (1989). Characterization of a cDNA encoding a new member of the glucocorticoid-responsive cytochromes P450 in human liver.. Arch. Biochem. Biophys. 274: 355 — 365.  PubMed DOI:10.1016/0003-9861(89)90449-9
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Jounaidi Y., Guzelian P.S., Maurel P., Vilarem M.J. (1994). Sequence of the 5'-flanking region of CYP3A5: comparative analysis with CYP3A4 and CYP3A7.. Biochem. Biophys. Res. Commun. 205: 1741 — 1747.  PubMed DOI:10.1006/bbrc.1994.2870
  • Finta C., Zaphiropoulos P.G. (2002). Intergenic mRNA molecules resulting from trans-splicing.. J. Biol. Chem. 277: 5882 — 5890.  PubMed DOI:10.1074/jbc.M109175200
  • Jounaidi Y., Hyrailles V., Gervot L., Maurel P. (1996). Detection of CYP3A5 allelic variant: a candidate for the polymorphic expression of the protein?. Biochem. Biophys. Res. Commun. 221: 466 — 470.  PubMed DOI:10.1006/bbrc.1996.0618
  • Chou F.C., Tzeng S.J., Huang J.D. (2001). Genetic polymorphism of cytochrome P450 3A5 in Chinese.. Drug Metab. Dispos. 29: 1205 — 1209.  PubMed

ПриміткиРедагувати

Див. такожРедагувати