CAPN3

білок-кодуючий ген Homo Sapiens

CAPN3 (англ. Calpain 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 821 амінокислот, а молекулярна маса — 94 254[4].

CAPN3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CAPN3, CANP3, CANPL3, LGMD2, LGMD2A, nCL-1, p94, calpain 3, LGMDR1, LGMDD4
Зовнішні ІД OMIM: 114240 MGI: 107437 HomoloGene: 52 GeneCards: CAPN3
Шаблон експресії
PBB GE CAPN3 gnf1h08766 s at fs.png

PBB GE CAPN3 gnf1h06575 at fs.png

PBB GE CAPN3 gnf1h02293 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001109761
NM_001177799
NM_007601
RefSeq (білок)
NP_001103231
NP_001171270
NP_031627
Локус (UCSC) Хр. 15: 42.36 – 42.41 Mb Хр. 2: 120.46 – 120.5 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MPTVISASVAPRTAAEPRSPGPVPHPAQSKATEAGGGNPSGIYSAIISRN
FPIIGVKEKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWK
RPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIP
HDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEF
WSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEIRDAPSDMYK
IMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLQ
DSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLDEVPFKGEK
VKLVRLRNPWGQVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMS
YEDFIYHFTKLEICNLTADALQSDKLQTWTVSVNEGRWVRGCSAGGCRNF
PDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLF
TIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLP
PSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTK
PIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEE
QQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKTHGFTLESCRSM
IALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNA
VNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFD
KDGDGIIKLNVLEWLQLTMYA

Кодований геном білок за функціями належить до гідролаз, протеаз, тіолових протеаз. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у цитоплазмі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Partha S.K., Ravulapalli R., Allingham J.S., Campbell R.L., Davies P.L. (2014). Crystal structure of calpain-3 penta-EF-hand (PEF) domain - a homodimerized PEF family member with calcium bound at the fifth EF-hand.. FEBS J. 281: 3138 — 3149.  PubMed DOI:10.1111/febs.12849
  • Penisson-Besnier I., Richard I., Dubas F., Beckmann J.S., Fardeau M. (1998). Pseudometabolic expression and phenotypic variability of calpain deficiency in two siblings.. Muscle Nerve 21: 1078 — 1080.  PubMed DOI:10.1002/(SICI)1097-4598(199808)21:8<1078::AID-MUS15>3.0.CO;2-Q
  • Haeffner K., Speer A., Huebner C., Voit T., Oexle K. (1998). A small in-frame deletion within the protease domain of muscle-specific calpain, p94 causes early-onset limb-girdle muscular dystrophy 2A.. Hum. Mutat. Suppl. 1: S298 — S300.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1480 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P20807 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати