Відкрити головне меню

ABO (англ. ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 354 амінокислот, а молекулярна маса — 40 934[5].

ABO
Protein ABO PDB 1lz0.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ABO, A3GALNT, A3GALT1, GTB, NAGAT, ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase), alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase
Зовнішні ІД OMIM: 110300 MGI: 2135738 HomoloGene: 69306 GeneCards: ABO
шифр КФ 2.4.1.37 2.4.1.40, 2.4.1.37
Пов'язані генетичні захворювання
малярія, дифузний токсичний зоб, Ожиріння, duodenal ulcer, Ішемічна хвороба серця, рак підшлункової залози, Graves' disease[1]
Шаблон експресії
PBB GE ABO 214504 at fs.png

PBB GE ABO 216929 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_020469
NM_030718
NM_001290444
RefSeq (білок)
NP_065202
NP_001277373
NP_109643
Локус (UCSC) Хр. 9: 133.25 – 133.28 Mb Хр. 2: 26.84 – 26.86 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERG
FCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTF
NIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYY
VFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRF
LSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRP
QSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVW
HDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQA
VRNP

Кодований геном білок за функціями належить до трансфераз, глікозилтрансфераз. Білок має сайт для зв'язування з іонами металів, іоном марганцю. Локалізований у мембрані, апараті гольджі. Також секретований назовні.

ЛітератураРедагувати

  • Yamamoto F., Clausen H., White T., Marken J., Hakomori S. (1990). Molecular genetic basis of the histo-blood group ABO system.. Nature 345: 229 — 233.  PubMed DOI:10.1038/345229a0
  • Bennett E.P., Steffensen R., Clausen H., Weghuis D.O., Geurts van Kessel A. (1995). Genomic cloning of the human histo-blood group ABO locus.. Biochem. Biophys. Res. Commun. 206: 318 — 325.  PubMed DOI:10.1006/bbrc.1995.1044
  • Bennett E.P., Steffensen R., Clausen H., Weghuis D.O., Geurts van Kessel A. (1995). Biochem. Biophys. Res. Commun. 211: 347 — 347.  PubMed DOI:10.1006/bbrc.1995.1817
  • Seltsam A., Das Gupta C., Bade-Doeding C., Blasczyk R. (2006). A weak blood group A phenotype caused by a translation-initiator mutation in the ABO gene.. Transfusion 46: 434 — 440.  PubMed DOI:10.1111/j.1537-2995.2006.00740.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Seltsam A., Hallensleben M., Kollmann A., Blasczyk R. (2003). The nature of diversity and diversification at the ABO locus.. Blood 102: 3035 — 3042.  PubMed DOI:10.1182/blood-2003-03-0955

ПриміткиРедагувати

Див. такожРедагувати