TRPM8

білок-кодуючий ген Homo Sapiens
(Перенаправлено з Рецептор холоду)

TRPM8 (англ. Transient receptor potential cation channel subfamily M member 8) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 1 104 амінокислот, а молекулярна маса — 127 685[6].

TRPM8
Ідентифікатори
Символи TRPM8, LTRPC6, TRPP8, transient receptor potential cation channel subfamily M member 8, trp-p8, LTrpC-6
Зовнішні ІД OMIM: 606678 MGI: 2181435 HomoloGene: 23433 GeneCards: TRPM8
Пов'язані генетичні захворювання
бічний аміотрофічний склероз, Мігрень, migraine with aura, migraine without aura[1]
Реагує на сполуку
Ментол, 5-benzyloxytryptamine, Анандамід, Канабідіол, Клотримазол, Тетрагідроканнабінол, Лінолева кислота, NADA[2]
Шаблон експресії
PBB GE TRPM8 220226 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_024080
NM_134252
RefSeq (білок)
NP_076985
NP_599013
Локус (UCSC) Хр. 2: 233.92 – 234.02 Mb Хр. 1: 88.28 – 88.39 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSFRAARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFK
KRECVFFTKDSKATENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPT
DAFGDIQFETLGKKGKYIRLSCDTDAEILYELLTQHWHLKTPNLVISVTG
GAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNT
ISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEGYFLAQYLMDDFTRDPL
YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
IVCFAQGGGKETLKAINTSIKNKIPCVVVEGSGQIADVIASLVEVEDALT
SSAVKEKLVRFLPRTVSRLPEEETESWIKWLKEILECSHLLTVIKMEEAG
DEIVSNAISYALYKAFSTSEQDKDNWNGQLKLLLEWNQLDLANDEIFTND
RRWESADLQEVMFTALIKDRPKFVRLFLENGLNLRKFLTHDVLTELFSNH
FSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRGFRKEDRNGRDEMDIEL
HDVSPITRHPLQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKT
LAKVKNDINAAGESEELANEYETRAVELFTECYSSDEDLAEQLLVYSCEA
WGGSNCLELAVEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLF
IIPLVGCGFVSFRKKPVDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLL
LFAYVLLMDFHSVPHPPELVLYSLVFVLFCDEVRQWYVNGVNYFTDLWNV
MDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFTLRLIHIFTVS
RNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIF
RSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPR
FPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYF
LVQEYCSRLNIPFPFIVFAYFYMVVKKCFKCCCKEKNMESSVCCFKNEDN
ETLAWEGVMKENYLVKINTKANDTSEEMRHRFRQLDTKLNDLKGLLKEIA
NKIK

Кодований геном білок за функцією належить до іонних каналів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт. Локалізований у клітинній мембрані, мембрані, ендоплазматичному ретикулумі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tsavaler L., Shapero M.H., Morkowski S., Laus R. (2001). Trp-p8, a novel prostate-specific gene, is up-regulated in prostate cancer and other malignancies and shares high homology with transient receptor potential calcium channel proteins.. Cancer Res. 61: 3760 — 3769.  PubMed

ПриміткиРедагувати

Див. такожРедагувати