Відкрити головне меню

PROC (англ. Protein C, inactivator of coagulation factors Va and VIIIa) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 461 амінокислот, а молекулярна маса — 52 071[2].

PROC
Ідентифікатори
Символи Protein C-Nagoyaactivated protein Cprepro-protein Cvitamin K-dependent protein CPROCanticoagulant protein Cautoprothrombin IIAtype I protein Cblood coagulation factor XIV
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE PROC 206259 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL
RHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHP
CASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHY
CLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRD
TEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLT
AAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREK
EAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEG
DSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIR
DKEAPQKSWAP

Кодований геном білок за функціями належить до гідролаз, протеаз, серинових протеаз, фосфопротеїнів. Задіяний у таких біологічних процесах як зсідання крові, гемостаз, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іоном кальцію. Локалізований у ендоплазматичному ретикулумі, апараті гольджі. Також секретований назовні.

ЛітератураРедагувати

  • Foster D.C., Yoshitake S., Davie E.W. (1985). The nucleotide sequence of the gene for human protein C.. Proc. Natl. Acad. Sci. U.S.A. 82: 4673 — 4677.  PubMed DOI:10.1073/pnas.82.14.4673
  • Plutzky J., Hoskins J.A., Long G.L., Crabtree G.R. (1986). Evolution and organization of the human protein C gene.. Proc. Natl. Acad. Sci. U.S.A. 83: 546 — 550.  PubMed DOI:10.1073/pnas.83.3.546
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Foster D.C., Davie E.W. (1984). Characterization of a cDNA coding for human protein C.. Proc. Natl. Acad. Sci. U.S.A. 81: 4766 — 4770.  PubMed DOI:10.1073/pnas.81.15.4766
  • Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. (2011). Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD.. Mol. Cell. Proteomics: —.  PubMed DOI:10.1074/mcp.M111.013649
  • Fisher C.L., Greengard J.S., Griffin J.H. (1994). Models of the serine protease domain of the human antithrombotic plasma factor activated protein C and its zymogen.. Protein Sci. 3: 588 — 599.  PubMed DOI:10.1002/pro.5560030407

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:9451 (англ.). Процитовано 28 серпня 2017. 
  2. UniProt, P04070 (англ.). Процитовано 28 серпня 2017. 

Див. такожРедагувати