Коактиватор ядерних рецепторів 3

білок-кодуючий ген Homo Sapiens

Коактиватор ядерних рецепторів 3 (англ. Nuclear receptor coactivator 3) – білок, який кодується геном NCOA3, розташованим у людини на довгому плечі 20-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 424 амінокислот, а молекулярна маса — 155 293[5]. Білок регулює ядерні рецептори та стимулює їх транскрипційну активність, тобто є активатором транскрипції. Працює як гістонова ацетилтрансфераза. Локалізований у цитоплазмі чи ядрі.

Коактиватор ядерних рецепторів 3
Protein NCOA3 PDB 1kbh.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NCOA3, ACTR, AIB-1, AIB1, CAGH16, CTG26, KAT13B, RAC3, SRC-3, SRC3, TNRC14, TNRC16, TRAM-1, bHLHe42, pCIP, nuclear receptor coactivator 3
Зовнішні ІД OMIM: 601937 MGI: 1276535 HomoloGene: 4764 GeneCards: NCOA3
Пов'язані генетичні захворювання
lymphoblastic leukemia[1]
Шаблон експресії
PBB GE NCOA3 209062 x at fs.png

PBB GE NCOA3 207700 s at fs.png

PBB GE NCOA3 209060 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_181659
NM_001174087
NM_001174088
NM_006534
NM_008679
NM_001374779
RefSeq (білок)
NP_001167558
NP_001167559
NP_006525
NP_858045
н/д
Локус (UCSC) Хр. 20: 47.5 – 47.66 Mb Хр. 2: 165.99 – 166.07 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAE
LISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADV
SSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQE
DLVNTSVYNILHEEDRKDFLKNLPKSTVNGVSWTNETQRQKSHTFNCRML
MKTPHDILEDINASPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVA
RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSK
LFRNPVTNDRHGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGG
MSMSPNQGLQMPSSRAYGLADPSTTGQMSGARYGGSSNIASLTPGPGMQS
PSSYQNNNYGLNMSSPPHGSPGLAPNQQNIMISPRNRGSPKIASHQFSPV
AGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDN
SPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKE
SSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESS
VSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAK
ITAEATGKDTSSITSCGDGNVVKQEQLSPKKKENNALLRYLLDRDDPSDA
LSKELQPQVEGVDNKMSQCTSSTIPSSSQEKDPKIKTETSEEGSGDLDNL
DAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLKSSQSVQSIRP
PYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
SMGGPNRNVTVTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLP
RPALGGSIPTLPLRSNSIPGARPVLQQQQQMLQMRPGEIPMGMGANPYGQ
AAASNQLGSWPDGMLSMEQVSHGTQNRPLLRNSLDDLVGPPSNLEGQSDE
RALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDAFQGQEA
AVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNSMMNQMNQQGNFPL
QGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENPTA
GGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPT
MPQAPPQQFPYQPNYGMGQQPDPAFGRVSSPPNAMMSSRMGPSQNPMMQH
PQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAVYSMVHMNGSSG
HMGQMNMNPMPMSGMPMGPDQKYC

Ген NCOA3Редагувати

Ген NCOA3 розташований на 20 хромосомі людини та складається з 22 екзонів, що було продемостровано в 2001 р.[6] Також має інші назви: AIB1, TRAM1.

ФункціяРедагувати

NCOA3 має властивості транскрипційного коактиватора та має декілька взаємодіючих доменів ядерних рецепторів, а також гістонової ацетилтрансферази. Цей ензим приймає учать в посиленні експресії генів, завдяки здатності зв'язуватись з промотором ДНК ліганд-активованими ядерними рецепторами, що призводить до посилення транскрипції.[7][8]

Клінічне значенняРедагувати

Ампліфікація та посилена експресія NCOA3 (AIB1) була визначена в культурах клітин раку молочної залози та раку яєчників, а також в біоптатах ТАПБ раку молочної залози.[9] Крім того, визначення взаємодії NCOA3 з PAX2 може бути використано для прогнозу ефективності тамоксифену для лікування естроген-залежного раку молочної залози.

Див. такожРедагувати

ЛітератураРедагувати

ПриміткиРедагувати

  1. Захворювання, генетично пов'язані з Коактиватор ядерних рецепторів 3 переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:7670 (англ.). Архів оригіналу за 27 Квітня 2018. Процитовано 26 квітня 2018. 
  5. UniProt, Q9Y6Q9 (англ.). Архів оригіналу за 26 Квітня 2018. Процитовано 26 квітня 2018. 
  6. Reiter R, Wellstein A, Riegel AT (October 2001). An isoform of the coactivator AIB1 that increases hormone and growth factor sensitivity is overexpressed in breast cancer.. J Biol Chem 276 (43): 39736–39741. PMID 11502741. doi:10.1074/jbc.M104744200. 
  7. Anzick SL, Kononen J, Walker RL, Azorsa DO, Tanner MM, Guan XY, Sauter G, Kallioniemi OP, Trent JM, Meltzer PS (August 1997). AIB1, a steroid receptor coactivator amplified in breast and ovarian cancer. Science 277 (5328): 965–8. PMID 9252329. doi:10.1126/science.277.5328.965. 
  8. Takeshita A, Cardona GR, Koibuchi N, Suen CS, Chin WW (October 1997). TRAM-1, A novel 160-kDa thyroid hormone receptor activator molecule, exhibits distinct properties from steroid receptor coactivator-1. J. Biol. Chem. 272 (44): 27629–34. PMID 9346901. doi:10.1074/jbc.272.44.27629. 
  9. Anzick SL, Kononen J, Walker RL, Azorsa DO, Tanner MM, Guan XY, Sauter G, Kallioniemi OP, Trent JM, Meltzer PS (1997). AIB1, a steroid receptor coactivator amplified in breast and ovarian cancer. Science 277 (5328): 965–8. PMID 9252329. doi:10.1126/science.277.5328.965.