Відкрити головне меню

Катехол-О-метилтрансфераза

COMT (англ. Catechol-O-methyltransferase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 271 амінокислот, а молекулярна маса — 30 037[2].

Катехол-О-метилтрансфераза
Ідентифікатори
Символи catechol O-methyltransferaseCOMTepididymis secretory sperm binding protein Li 98ntesticular tissue protein Li 42catechol-O-methyltransferase isoformuniprot:P21964
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE COMT 208818 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLL
MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIV
DAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQ
RMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPD
TLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEY
REVVDGLEKAIYKGPGSEAGP

Кодований геном білок за функціями належить до трансфераз, метилтрансфераз, фосфопротеїнів. Білок має сайт для зв'язування з іонами металів, іоном магнію, S-аденозил-L-метіоніном. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

ЛітератураРедагувати

  • Lundstroem K., Salminen M., Jalanko A., Savolainen R., Ulmanen I. (1991). Cloning and characterization of human placental catechol-O-methyltransferase cDNA.. DNA Cell Biol. 10: 181 — 189.  PubMed DOI:10.1089/dna.1991.10.181
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tilgmann C., Kalkkinen N. (1991). Purification and partial sequence analysis of the soluble catechol-O-methyltransferase from human placenta: comparison to the rat liver enzyme.. Biochem. Biophys. Res. Commun. 174: 995 — 1002.  PubMed DOI:10.1016/0006-291X(91)91517-G
  • Ulmanen I., Lundstroem K. (1991). Cell-free synthesis of rat and human catechol O-methyltransferase. Insertion of the membrane-bound form into microsomal membranes in vitro.. Eur. J. Biochem. 202: 1013 — 1020.  PubMed DOI:10.1111/j.1432-1033.1991.tb16464.x
  • Rutherford K., Le Trong I., Stenkamp R.E., Parson W.W. (2008). Crystal structures of human 108V and 108M catechol O-methyltransferase.. J. Mol. Biol. 380: 120 — 130.  PubMed DOI:10.1016/j.jmb.2008.04.040
  • Rutherford K., Alphandery E., McMillan A., Daggett V., Parson W.W. (2008). The V108M mutation decreases the structural stability of catechol O-methyltransferase.. Biochim. Biophys. Acta 1784: 1098 — 1105.  PubMed DOI:10.1016/j.bbapap.2008.04.006

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:2228 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, P21964 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати