Відкрити головне меню

CASP9 (англ. Caspase 9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 416 амінокислот, а молекулярна маса — 46 281[4].

CASP9
Protein CASP9 PDB 1jxq.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CASP9, APAF-3, APAF3, ICE-LAP6, MCH6, PPP1R56, caspase 9
Зовнішні ІД OMIM: 602234 MGI: 1277950 HomoloGene: 31024 GeneCards: CASP9
Шаблон експресії
PBB GE CASP9 210775 x at fs.png

PBB GE CASP9 203984 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001229
NM_001278054
NM_032996
NM_001277932
NM_015733
NM_001355176
RefSeq (білок)
NP_001220
NP_001264983
NP_127463
NP_001264861
NP_056548
NP_001342105
Локус (UCSC) Хр. 1: 15.49 – 15.53 Mb Хр. 4: 141.79 – 141.82 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGS
RRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSK
PTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNAD
LAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFM
VEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAV
YGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPG
FVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQM
PGCFNFLRKKLFFKTS

Кодований геном білок за функціями належить до гідролаз, протеаз, тіолових протеаз. Задіяний у такому біологічному процесі як апоптоз.

ЛітератураРедагувати

  • Seol D.W., Billiar T.R. (1999). A caspase-9 variant missing the catalytic site is an endogenous inhibitor of apoptosis.. J. Biol. Chem. 274: 2072 — 2076.  PubMed DOI:10.1074/jbc.274.4.2072
  • Wang P., Shi T., Ma D. (2006). Cloning of a novel human caspase-9 splice variant containing only the CARD domain.. Life Sci. 79: 934 — 940.  PubMed DOI:10.1016/j.lfs.2006.04.026
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bartke T., Pohl C., Pyrowolakis G., Jentsch S. (2004). Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2/E3 ubiquitin ligase.. Mol. Cell 14: 801 — 811.  PubMed DOI:10.1016/j.molcel.2004.05.018
  • Checinska A., Giaccone G., Rodriguez J.A., Kruyt F.A.E., Jimenez C.R. (2009). Comparative proteomics analysis of caspase-9-protein complexes in untreated and cytochrome c/dATP stimulated lysates of NSCLC cells.. J. Proteomics 72: 575 — 585.  PubMed DOI:10.1016/j.jprot.2008.11.016
  • Renatus M., Stennicke H.R., Scott F.L., Liddington R.C., Salvesen G.S. (2001). Dimer formation drives the activation of the cell death protease caspase 9.. Proc. Natl. Acad. Sci. U.S.A. 98: 14250 — 14255.  PubMed DOI:10.1073/pnas.231465798

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1511 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P55211 (англ.). Процитовано 25 серпня 2017. 

Див. такожРедагувати