Відкрити головне меню

CYP19A1 (англ. Cytochrome P450 family 19 subfamily A member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 503 амінокислот, а молекулярна маса — 57 883[2].

CYP19A1
Ідентифікатори
Символи estrogen synthasemicrosomal monooxygenaseestrogen synthetasearomataseCYP19A1cytochrome P-450AROMCytochrome P450 family 19 subfamily A member 1cytochrome P450subfamily XIX (aromatization of androgens)CYPXIXcytochrome P450 19A1cytochrome P450family 19subfamily Apolypeptide 1flavoprotein-linked monooxygenase
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE PGR 208305 at tn.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGP
GYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS
SSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMK
ALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSN
TLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKD
LKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDI
QKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGR
MHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRGCAGKYIAMVMMKAI
LVTLLRRFHVKTLQGQCVESIQKIHDLSLHPDETKNMLEMIFTPRNSDRC
LEH

Кодований геном білок за функцією належить до оксидоредуктаз. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом. Локалізований у мембрані.

ЛітератураРедагувати

  • Harada N. (1988). Cloning of a complete cDNA encoding human aromatase: immunochemical identification and sequence analysis.. Biochem. Biophys. Res. Commun. 156: 725 — 732.  PubMed DOI:10.1016/S0006-291X(88)80903-3
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Evans C.T., Ledesma D.B., Schulz T.Z., Simpson E.R., Mendelson C.R. (1986). Isolation and characterization of a complementary DNA specific for human aromatase-system cytochrome P-450 mRNA.. Proc. Natl. Acad. Sci. U.S.A. 83: 6387 — 6391.  PubMed DOI:10.1073/pnas.83.17.6387
  • Chen S., Shively J.E., Nakajin S., Shinoda M., Hall P.F. (1986). Amino terminal sequence analysis of human placenta aromatase.. Biochem. Biophys. Res. Commun. 135: 713 — 719.  PubMed DOI:10.1016/0006-291X(86)90987-3
  • Honda S., Harada N., Takagi Y. (1994). Novel exon 1 of the aromatase gene specific for aromatase transcripts in human brain.. Biochem. Biophys. Res. Commun. 198: 1153 — 1160.  PubMed DOI:10.1006/bbrc.1994.1163
  • Ghosh D., Griswold J., Erman M., Pangborn W. (2009). Structural basis for androgen specificity and oestrogen synthesis in human aromatase.. Nature 457: 219 — 223.  PubMed DOI:10.1038/nature07614

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:2594 (англ.). Процитовано 11 вересня 2017. 
  2. UniProt, P11511 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати