Відкрити головне меню

Альфа-2-макроглобулін (англ. Alpha-2-macroglobulin) – білок, який кодується геном A2M, розташованим у людей на короткому плечі 12-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 474 амінокислот, а молекулярна маса — 163 291[4].

Альфа-2-макроглобулін
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи A2M, A2MD, CPAMD5, FWP007, S863-7, transcuprein, alpha-2-macroglobulin
Зовнішні ІД OMIM: 103950 MGI: 2449119 HomoloGene: 37248 GeneCards: A2M
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000014
NM_001347423
NM_001347424
NM_001347425
NM_175628
RefSeq (білок)
NP_000005
NP_001334352
NP_001334353
NP_001334354
NP_783327
Локус (UCSC) Хр. 12: 9.07 – 9.12 Mb Хр. 6: 121.64 – 121.68 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Великий білок плазми крові, синтезується клітинами печінки.

Послідовність амінокислот
1020304050
MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVL
LSYLNETVTVSASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEV
MFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKPGQTVKFRVVS
MDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQ
GSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSV
CGLYTYGKPVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCF
YQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKL
SFVKVDSHFRQGIPFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTD
EHGLVQFSINTTNVMGTSLTVRVNYKDRSPCYGYQWVSEEHEEAHHTAYL
VFSPSKSFVHLEPMSHELPCGHTQTVQAHYILNGGTLLGLKKLSFYYLIM
AKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARLLIYAVLPTGD
VIGDSAKYDVENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAV
DQSVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDNEDCINRHNVYI
NGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGP
EGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNSAG
VAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPY
SVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVEKEQAPHCICA
NGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVI
KPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSV
LGDILGSAMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEI
KSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGRNQGNTWLTAFVLKTFA
QARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVEDEVT
LSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGDHGSHVYTKALL
AYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQ
APSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSS
TQDTVVALHALSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLL
QQVSLPELPGEYSMKVTGEGCVYLQTSLKYNILPEKEEFPFALGVQTLPQ
TCDEPKAHTSFQISLSVSYTGSRSASNMAIVDVKMVSGFIPLKPTVKMLE
RSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVKVY
DYYETDEFAIAEYNAPCSKDLGNA

Цей білок за функціями належить до інгібіторів протеаз, зокрема серинових протеаз. Пригнічує активність плазміну. Секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Matthijs G., Devriendt K., Cassiman J.-J., van den Berghe H., Marynen P. (1992). Structure of the human alpha-2 macroglobulin gene and its promotor.. Biochem. Biophys. Res. Commun. 184: 596 — 603.  PubMed DOI:10.1016/0006-291X(92)90631-T
  • Marynen P., Devriendt K., van den Berghe H., Cassiman J.-J. (1990). A genetic polymorphism in a functional domain of human pregnancy zone protein: the bait region. Genomic structure of the bait domains of human pregnancy zone protein and alpha 2 macroglobulin.. FEBS Lett. 262: 349 — 352.  PubMed DOI:10.1016/0014-5793(90)80226-9
  • Poller W., Faber J.-P., Klobeck G., Olek K. (1992). Cloning of the human alpha 2-macroglobulin gene and detection of mutations in two functional domains: the bait region and the thiolester site.. Hum. Genet. 88: 313 — 319.  PubMed DOI:10.1007/BF00197266
  • Hall P.K., Nelles L.P., Travis J., Roberts R.C. (1981). Proteolytic cleavage sites on alpha 2-macroglobulin resulting in proteinase binding are different for trypsin and Staphylococcus aureus V-8 proteinase.. Biochem. Biophys. Res. Commun. 100: 8 — 16.  PubMed DOI:10.1016/S0006-291X(81)80055-1
  • Mortensen S.B., Sottrup-Jensen L., Hansen H.F., Petersen T.E., Magnusson S. (1981). Primary and secondary cleavage sites in the bait region of alpha 2-macroglobulin.. FEBS Lett. 135: 295 — 300.  PubMed DOI:10.1016/0014-5793(81)80804-6
  • К. Н. Веремеенко, А. И. Кизим, А. И. Терзов, В. Е. Досенко, О. А. Носенко (1998). Влияние ингибиторов плазмы крови на активность сериновых и цистеиновых протеиназ. Український біохімічний журнал 70 (6): 35— 42. (рос.)
  • К.Н. Веремеенко, А.И. Кизим, А.И. Терзов (2005). Архівована копія. Український біохімічний журнал (4): 88–95. Архів оригіналу за 12 квітень 2016. Процитовано 31 січень 2017.  Вказано більш, ніж один |назва= та |title= (довідка)(рос.)

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P01023 (англ.). Процитовано 30 січня 2017. 

Див. такожРедагувати