Відкрити головне меню

ZFP42 (англ. ZFP42 zinc finger protein) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 310 амінокислот, а молекулярна маса — 34 802[4].

ZFP42
Ідентифікатори
Символи ZFP42, REX1, ZNF754, REX-1, zfp-42, Rex1, ZFP42 zinc finger protein
Зовнішні ІД OMIM: 614572 MGI: 99187 HomoloGene: 7601 GeneCards: ZFP42
Шаблон експресії
PBB GE ZFP42 gnf1h06817 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001304358
NM_174900
NM_009556
RefSeq (білок)
NP_001291287
NP_777560
NP_033582
Локус (UCSC) Хр. 4: 188 – 188.01 Mb Хр. 8: 43.3 – 43.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC
DGYVCYEPGPQALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKK
GSEQQLSQKVFEASSLECSLEYMKKGVKKELPQKIVGENSLEYSEYMTGK
KLPPGGIPGIDLSDPKQLAEFARKKPPINKEYDSLSAIACPQSGCTRKLR
NRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFE
GCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHA
NTNKNEQEGK

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

ЛітератураРедагувати

  • Mongan N.P., Martin K.M., Gudas L.J. (2006). The putative human stem cell marker, Rex-1 (Zfp42): structural classification and expression in normal human epithelial and carcinoma cell cultures.. Mol. Carcinog. 45: 887 — 900.  PubMed DOI:10.1002/mc.20186

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:30949 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q96MM3 (англ.). Процитовано 30 серпня 2017. 

Див. такожРедагувати