YWHAB

білок-кодуючий ген Homo Sapiens

YWHAB (англ. Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 246 амінокислот, а молекулярна маса — 28 082[4].

YWHAB
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи YWHAB, GW128, HEL-S-1, HS1, KCIP-1, YWHAA, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta
Зовнішні ІД OMIM: 601289 MGI: 1891917 HomoloGene: 20724 GeneCards: YWHAB
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_139323
NM_003404
NM_018753
RefSeq (білок)
NP_003395
NP_647539
NP_061223
Локус (UCSC) Хр. 20: 44.89 – 44.91 Mb Хр. 2: 163.84 – 163.86 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAY
KNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVL
ELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQA
YQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDE
AIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Задіяний у такому біологічному процесі як взаємодія хазяїн-вірус. Локалізований у цитоплазмі.

Література ред.

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Greninger A.L., Knudsen G.M., Betegon M., Burlingame A.L., DeRisi J.L. (2013). ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding. MBio. 4: E00098—E00098. PMID 23572552 DOI:10.1128/mBio.00098-13
  • Yoshida K., Yamaguchi T., Natsume T., Kufe D., Miki Y. (2005). JNK phosphorylation of 14-3-3 proteins regulates nuclear targeting of c-Abl in the apoptotic response to DNA damage. Nat. Cell Biol. 7: 278—285. PMID 15696159 DOI:10.1038/ncb1228
  • Liu Y., Ross J.F., Bodine P.V.N., Billiard J. (2007). Homodimerization of Ror2 tyrosine kinase receptor induces 14-3-3(beta) phosphorylation and promotes osteoblast differentiation and bone formation. Mol. Endocrinol. 21: 3050—3061. PMID 17717073 DOI:10.1210/me.2007-0323
  • Cariolato L., Cavin S., Diviani D. (2011). A-kinase anchoring protein (AKAP)-Lbc anchors a PKN-based signaling complex involved in alpha1-adrenergic receptor-induced p38 activation. J. Biol. Chem. 286: 7925—7937. PMID 21224381 DOI:10.1074/jbc.M110.185645
  • Lin A.E., Greco T.M., Dohner K., Sodeik B., Cristea I.M. (2013). A proteomic perspective of inbuilt viral protein regulation: pUL46 tegument protein is targeted for degradation by ICP0 during herpes simplex virus type 1 infection. Mol. Cell. Proteomics. 12: 3237—3252. PMID 23938468 DOI:10.1074/mcp.M113.030866

Примітки ред.

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:12849 (англ.) . Архів оригіналу за 14 жовтня 2017. Процитовано 6 лютого 2017.
  4. UniProt, P31946 (англ.) . Архів оригіналу за 14 квітня 2017. Процитовано 6 лютого 2017.

Див. також ред.