Відкрити головне меню

YBX1 (англ. Y-box binding protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 324 амінокислот, а молекулярна маса — 35 924[4].

YBX1
Protein YBX1 PDB 1h95.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи YBX1, BP-8, CSDA2, CSDB, DBPB, MDR-NF1, NSEP-1, NSEP1, YB-1, YB1, CBF-A, EFI-A, Y-box binding protein 1
Зовнішні ІД OMIM: 154030 MGI: 99146 HomoloGene: 88707 GeneCards: YBX1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004559
NM_011732
RefSeq (білок)
NP_004550
NP_035862
Локус (UCSC) Хр. 1: 42.68 – 42.7 Mb Хр. 4: 119.28 – 119.29 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGG
DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYL
RSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPR
RRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRR
PYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPP
RQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
KETKAADPPAENSSAPEAEQGGAE

Кодований геном білок за функціями належить до репресорів, активаторів, мітогенів. Задіяний у таких біологічних процесах як процесінг мРНК, сплайсінг мРНК, транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК, РНК. Локалізований у цитоплазмі, ядрі. Також секретований назовні.

ЛітератураРедагувати

  • Sakura H., Maekawa T., Imamoto F., Yasuda K., Ishii S. (1988). Two human genes isolated by a novel method encode DNA-binding proteins containing a common region of homology.. Gene 73: 499 — 507.  PubMed DOI:10.1016/0378-1119(88)90514-8
  • Didier D.K., Schiffenbauer J., Woulfe S.L., Zacheis M., Schwartz B.D. (1988). Characterization of the cDNA encoding a protein binding to the major histocompatibility complex class II Y box.. Proc. Natl. Acad. Sci. U.S.A. 85: 7322 — 7326.  PubMed DOI:10.1073/pnas.85.19.7322
  • Kolluri R., Kinniburgh A.J. (1991). Full length cDNA sequence encoding a nuclease-sensitive element DNA binding protein.. Nucleic Acids Res. 19: 4771 — 4771.  PubMed DOI:10.1093/nar/19.17.4771
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Capowski E.E., Esnault S., Bhattacharya S., Malter J.S. (2001). Y box-binding factor promotes eosinophil survival by stabilizing granulocyte-macrophage colony-stimulating factor mRNA.. J. Immunol. 167: 5970 — 5976.  PubMed DOI:10.4049/jimmunol.167.10.5970
  • Gaudreault I., Guay D., Lebel M. (2004). YB-1 promotes strand separation in vitro of duplex DNA containing either mispaired bases or cisplatin modifications, exhibits endonucleolytic activities and binds several DNA repair proteins.. Nucleic Acids Res. 32: 316 — 327.  PubMed DOI:10.1093/nar/gkh170

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8014 (англ.). Процитовано 6 лютого 2017. 
  4. UniProt, P67809 (англ.). Процитовано 6 лютого 2017. 

Див. такожРедагувати