Відкрити головне меню

WSB1 (англ. WD repeat and SOCS box containing 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 421 амінокислот, а молекулярна маса — 47 432[4].

WSB1
Ідентифікатори
Символи WSB1, SWIP1, WSB-1, WD repeat and SOCS box containing 1
Зовнішні ІД OMIM: 610091 MGI: 1926139 HomoloGene: 9218 GeneCards: WSB1
Шаблон експресії
PBB GE WSB1 201296 s at fs.png

PBB GE WSB1 210561 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_015626
NM_134264
NM_134265
NM_001348350
NM_001042565
NM_019653
RefSeq (білок)
NP_056441
NP_599027
NP_001335279
NP_001036030
NP_062627
Локус (UCSC) Хр. 17: 27.29 – 27.32 Mb Хр. 11: 79.24 – 79.25 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFA
WSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPR
EHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNG
RIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDL
KDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIR
KLEGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPP
PTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAP
LSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMP
TQEVQELPIPSKLLEFLSYRI

Задіяний у таких біологічних процесах, як убіквітинування білків, альтернативний сплайсинг.

ЛітератураРедагувати

  • Vasiliauskas D., Hancock S., Stern C.D. (1999). SWiP-1: novel SOCS box containing WD-protein regulated by signalling centres and by Shh during development.. Mech. Dev. 82: 79 — 94.  PubMed DOI:10.1016/S0925-4773(99)00014-3
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:19221 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9Y6I7 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати