VAPB

білок-кодуючий ген Homo Sapiens

VAPB (англ. VAMP associated protein B and C) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 243 амінокислот, а молекулярна маса — 27 228[5].

VAPB
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи VAPB, ALS8, VAMP-B, VAP-B, VAMP (vesicle-associated membrane protein)-associated protein B and C, VAMP associated protein B and C
Зовнішні ІД OMIM: 605704 MGI: 1928744 HomoloGene: 36163 GeneCards: VAPB
Пов'язані генетичні захворювання
amyotrophic lateral sclerosis type 8[1]
Шаблон експресії
PBB GE VAPB 202549 at fs.png

PBB GE VAPB 202550 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001195677
NM_004738
NM_019806
RefSeq (білок)
NP_001182606
NP_004729
NP_062780
Локус (UCSC) Хр. 20: 58.39 – 58.45 Mb Хр. 2: 173.58 – 173.63 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPR
RYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTS
DMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTET
PIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRK
TVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, відповідь на порушення конформації білку, ацетилювання, альтернативний сплайсинг. Локалізований у мембрані, ендоплазматичному ретикулумі.

ЛітератураРедагувати

  • Nishimura Y., Hayashi M., Inada H., Tanaka T. (1999). Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins.. Biochem. Biophys. Res. Commun. 254: 21 — 26.  PubMed DOI:10.1006/bbrc.1998.9876
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kanekura K., Nishimoto I., Aiso S., Matsuoka M. (2006). Characterization of amyotrophic lateral sclerosis-linked P56S mutation of vesicle-associated membrane protein-associated protein B (VAPB/ALS8).. J. Biol. Chem. 281: 30223 — 30233.  PubMed DOI:10.1074/jbc.M605049200
  • Saita S., Shirane M., Natume T., Iemura S., Nakayama K.I. (2009). Promotion of neurite extension by protrudin requires its interaction with vesicle-associated membrane protein-associated protein.. J. Biol. Chem. 284: 13766 — 13777.  PubMed DOI:10.1074/jbc.M807938200
  • Matsuzaki F., Shirane M., Matsumoto M., Nakayama K.I. (2011). Protrudin serves as an adaptor molecule that connects KIF5 and its cargoes in vesicular transport during process formation.. Mol. Biol. Cell 22: 4602 — 4620.  PubMed DOI:10.1091/mbc.E11-01-0068
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111

ПриміткиРедагувати

  1. Захворювання, генетично пов'язані з VAPB переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:12649 (англ.). Архів оригіналу за 21 жовтня 2018. Процитовано 12 вересня 2017. 
  5. UniProt, O95292 (англ.). Архів оригіналу за 9 квітня 2017. Процитовано 12 вересня 2017. 

Див. такожРедагувати