TRAP1 (англ. TNF receptor associated protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 704 амінокислот, а молекулярна маса — 80 110[4].

TRAP1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TRAP1, HSP 75, HSP75, HSP90L, TRAP-1, TNF receptor associated protein 1
Зовнішні ІД OMIM: 606219 MGI: 1915265 HomoloGene: 9457 GeneCards: TRAP1
Шаблон експресії
PBB GE TRAP1 201391 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001272049
NM_016292
NM_026508
RefSeq (білок)
NP_001258978
NP_057376
NP_080784
Локус (UCSC) Хр. 16: 3.65 – 3.72 Mb Хр. 16: 4.04 – 4.08 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPA
WSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDI
VARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAE
KGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQ
FGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTG
TKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWM
MDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKP
SMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNL
SRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMRE
GIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYL
CAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISV
ETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVT
LRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHAL
IKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKA
LERH

Кодований геном білок за функцією належить до шаперонів. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у мембрані, мітохондрії, внутрішній мембрані мітохондрії.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Song H.Y., Dunbar J.D., Zhang Y.X., Guo D., Donner D.B. (1995). Identification of a protein with homology to hsp90 that binds the type 1 tumor necrosis factor receptor.. J. Biol. Chem. 270: 3574 — 3581.  PubMed DOI:10.1074/jbc.270.28.16630

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16264 (англ.). Процитовано 6 лютого 2017. 
  4. UniProt, Q12931 (англ.). Процитовано 6 лютого 2017. 

Див. такожРедагувати