TOP1

білок-кодуючий ген Homo Sapiens

TOP1 (англ. Topoisomerase (DNA) I) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 765 амінокислот, а молекулярна маса — 90 726[4].

TOP1
Protein TOP1 PDB 1a31.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TOP1, TOPI, topoisomerase (DNA) I, DNA topoisomerase I
Зовнішні ІД OMIM: 126420 MGI: 98788 HomoloGene: 2467 GeneCards: TOP1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003286
NM_009408
RefSeq (білок)
NP_003277
NP_033434
Локус (UCSC) Хр. 20: 41.03 – 41.12 Mb Хр. 2: 160.49 – 160.56 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHS
NSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
KIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPK
KIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEE
QKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLS
PKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKC
DFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERI
ANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHK
WKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRL
KKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETAD
TVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKN
LQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQ
QLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTK
IDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMK
LEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQRE
KFAWAIDMADEDYEF

Кодований геном білок за функціями належить до ізомераз, топоізомераз. Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, біологічні ритми. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

ЛітератураРедагувати

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11986 (англ.). Архів оригіналу за 18 червня 2017. Процитовано 22 серпня 2017. 
  4. UniProt, P11387 (англ.). Архів оригіналу за 8 серпня 2017. Процитовано 22 серпня 2017. 

Див. такожРедагувати